You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03958
Secondary Accession Numbers
  • 9546
Name Multidrug resistance-associated protein 5
Synonyms
  1. ATP-binding cassette sub-family C member 5
  2. MOAT-C
  3. Multi-specific organic anion transporter C
  4. SMRP
  5. pABC11
Gene Name ABCC5
Protein Type Transporter
Biological Properties
General Function Involved in ATP binding
Specific Function Acts as a multispecific organic anion pump which can transport nucleotide analogs
Pathways
  • Acetaminophen Metabolism Pathway
  • Azathioprine Action Pathway
  • Mercaptopurine Action Pathway
  • Mercaptopurine Metabolism Pathway
  • Thioguanine Action Pathway
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
active transmembrane transporter activity
primary active transmembrane transporter activity
p-p-bond-hydrolysis-driven transmembrane transporter activity
atpase activity, coupled to transmembrane movement of substances
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
transmembrane transporter activity
atpase activity
transporter activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q27
SNPs ABCC5
Gene Sequence
>4314 bp
ATGAAGGATATCGACATAGGAAAAGAGTATATCATCCCCAGTCCTGGGTATAGAAGTGTG
AGGGAGAGAACCAGCACTTCTGGGACGCACAGAGACCGTGAAGATTCCAAGTTCAGGAGA
ACTCGACCGTTGGAATGCCAAGATGCCTTGGAAACAGCAGCCCGAGCCGAGGGCCTCTCT
CTTGATGCCTCCATGCATTCTCAGCTCAGAATCCTGGATGAGGAGCATCCCAAGGGAAAG
TACCATCATGGCTTGAGTGCTCTGAAGCCCATCCGGACTACTTCCAAACACCAGCACCCA
GTGGACAATGCTGGGCTTTTTTCCTGTATGACTTTTTCGTGGCTTTCTTCTCTGGCCCGT
GTGGCCCACAAGAAGGGGGAGCTCTCAATGGAAGACGTGTGGTCTCTGTCCAAGCACGAG
TCTTCTGACGTGAACTGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTT
GGGCCAGACGCTGCTTCCCTGCGAAGGGTTGTGTGGATCTTCTGCCGCACCAGGCTCATC
CTGTCCATCGTGTGCCTGATGATCACGCAGCTGGCTGGCTTCAGTGGACCAGCCTTCATG
GTGAAACACCTCTTGGAGTATACCCAGGCAACAGAGTCTAACCTGCAGTACAGCTTGTTG
TTAGTGCTGGGCCTCCTCCTGACGGAAATCGTGCGGTCTTGGTCGCTTGCACTGACTTGG
GCATTGAATTACCGAACCGGTGTCCGCTTGCGGGGGGCCATCCTAACCATGGCATTTAAG
AAGATCCTTAAGTTAAAGAACATTAAAGAGAAATCCCTGGGTGAGCTCATCAACATTTGC
TCCAACGATGGGCAGAGAATGTTTGAGGCAGCAGCCGTTGGCAGCCTGCTGGCTGGAGGA
CCCGTTGTTGCCATCTTAGGCATGATTTATAATGTAATTATTCTGGGACCAACAGGCTTC
CTGGGATCAGCTGTTTTTATCCTCTTTTACCCAGCAATGATGTTTGCATCACGGCTCACA
GCATATTTCAGGAGAAAATGCGTGGCCGCCACGGATGAACGTGTCCAGAAGATGAATGAA
GTTCTTACTTACATTAAATTTATCAAAATGTATGCCTGGGTCAAAGCATTTTCTCAGAGT
GTTCAAAAAATCCGCGAGGAGGAGCGTCGGATATTGGAAAAAGCTGGGTACTTCCAGAGC
ATCACTGTGGGTGTGGCTCCCATTGTGGTGGTGATTGCCAGCGTGGTGACCTTCTCTGTT
CATATGACCCTGGGCTTCGATCTGACAGCAGCACAGGCTTTCACAGTGGTGACAGTCTTC
AATTCCATGACTTTTGCTTTGAAAGTAACACCGTTTTCAGTAAAGTCCCTCTCAGAAGCC
TCAGTGGCTGTTGACAGATTTAAGAGTTTGTTTCTAATGGAAGAGGTTCACATGATAAAG
AACAAACCAGCCAGTCCTCACATCAAGATAGAGATGAAAAATGCCACCTTGGCATGGGAC
TCCTCCCACTCCAGTATCCAGAACTCGCCCAAGCTGACCCCCAAAATGAAAAAAGACAAG
AGGGCTTCCAGGGGCAAGAAAGAGAAGGTGAGGCAGCTGCAGCGCACTGAGCATCAGGCG
GTGCTGGCAGAGCAGAAAGGCCACCTCCTCCTGGACAGTGACGAGCGGCCCAGTCCCGAA
GAGGAAGAAGGCAAGCACATCCACCTGGGCCACCTGCGCTTACAGAGGACACTGCACAGC
ATCGATCTGGAGATCCAAGAGGGTAAACTGGTTGGAATCTGTGGCAGTGTGGGAAGTGGA
AAAACCTCTCTCATTTCAGCCATTTTAGGCCAGATGACGCTTCTAGAGGGCAGCATTGCA
ATCAGTGGAACCTTCGCTTATGTGGCCCAGCAGGCCTGGATCCTCAATGCTACTCTGAGA
GACAACATCCTGTTTGGGAAGGAATATGATGAAGAAAGATACAACTCTGTGCTGAACAGC
TGCTGCCTGAGGCCTGACCTGGCCATTCTTCCCAGCAGCGACCTGACGGAGATTGGAGAG
CGAGGAGCCAACCTGAGCGGTGGGCAGCGCCAGAGGATCAGCCTTGCCCGGGCCTTGTAT
AGTGACAGGAGCATCTACATCCTGGACGACCCCCTCAGTGCCTTAGATGCCCATGTGGGC
AACCACATCTTCAATAGTGCTATCCGGAAACATCTCAAGTCCAAGACAGTTCTGTTTGTT
ACCCACCAGTTACAGTACCTGGTTGACTGTGATGAAGTGATCTTCATGAAAGAGGGCTGT
ATTACGGAAAGAGGCACCCATGAGGAACTGATGAATTTAAATGGTGACTATGCTACCATT
TTTAATAACCTGTTGCTGGGAGAGACACCGCCAGTTGAGATCAATTCAAAAAAGGAAACC
AGTGGTTCACAGAAGAAGTCACAAGACAAGGGTCCTAAAACAGGATCAGTAAAGAAGGAA
AAAGCAGTAAAGCCAGAGGAAGGGCAGCTTGTGCAGCTGGAAGAGAAAGGGCAGGGTTCA
GTGCCCTGGTCAGTATATGGTGTCTACATCCAGGCTGCTGGGGGCCCCTTGGCATTCCTG
GTTATTATGGCCCTTTTCATGCTGAATGTAGGCAGCACCGCCTTCAGCACCTGGTGGTTG
AGTTACTGGATCAAGCAAGGAAGCGGGAACACCACTGTGACTCGAGGGAACGAGACCTCG
GTGAGTGACAGCATGAAGGACAATCCTCATATGCAGTACTATGCCAGCATCTACGCCCTC
TCCATGGCAGTCATGCTGATCCTGAAAGCCATTCGAGGAGTTGTCTTTGTCAAGGGCACG
CTGCGAGCTTCCTCCCGGCTGCATGACGAGCTTTTCCGAAGGATCCTTCGAAGCCCTATG
AAGTTTTTTGACACGACCCCCACAGGGAGGATTCTCAACAGGTTTTCCAAAGACATGGAT
GAAGTTGACGTGCGGCTGCCGTTCCAGGCCGAGATGTTCATCCAGAACGTTATCCTGGTG
TTCTTCTGTGTGGGAATGATCGCAGGAGTCTTCCCGTGGTTCCTTGTGGCAGTGGGGCCC
CTTGTCATCCTCTTTTCAGTCCTGCACATTGTCTCCAGGGTCCTGATTCGGGAGCTGAAG
CGTCTGGACAATATCACGCAGTCACCTTTCCTCTCCCACATCACGTCCAGCATACAGGGC
CTTGCCACCATCCACGCCTACAATAAAGGGCAGGAGTTTCTGCACAGATACCAGGAGCTG
CTGGATGACAACCAAGCTCCTTTTTTTTTGTTTACGTGTGCGATGCGGTGGCTGGCTGTG
CGGCTGGACCTCATCAGCATCGCCCTCATCACCACCACGGGGCTGATGATCGTTCTTATG
CACGGGCAGATTCCCCCAGCCTATGCGGGTCTCGCCATCTCTTATGCTGTCCAGTTAACG
GGGCTGTTCCAGTTTACGGTCAGACTGGCATCTGAGACAGAAGCTCGATTCACCTCGGTG
GAGAGGATCAATCACTACATTAAGACTCTGTCCTTGGAAGCACCTGCCAGAATTAAGAAC
AAGGCTCCCTCCCCTGACTGGCCCCAGGAGGGAGAGGTGACCTTTGAGAACGCAGAGATG
AGGTACCGAGAAAACCTCCCTCTCGTCCTAAAGAAAGTATCCTTCACGATCAAACCTAAA
GAGAAGATTGGCATTGTGGGGCGGACAGGATCAGGGAAGTCCTCGCTGGGGATGGCCCTC
TTCCGTCTGGTGGAGTTATCTGGAGGCTGCATCAAGATTGATGGAGTGAGAATCAGTGAT
ATTGGCCTTGCCGACCTCCGAAGCAAACTCTCTATCATTCCTCAAGAGCCGGTGCTGTTC
AGTGGCACTGTCAGATCAAATTTGGACCCCTTCAACCAGTACACTGAAGACCAGATTTGG
GATGCCCTGGAGAGGACACACATGAAAGAATGTATTGCTCAGCTACCTCTGAAACTTGAA
TCTGAAGTGATGGAGAATGGGGATAACTTCTCAGTGGGGGAACGGCAGCTCTTGTGCATA
GCTAGAGCCCTGCTCCGCCACTGTAAGATTCTGATTTTAGATGAAGCCACAGCTGCCATG
GACACAGAGACAGACTTATTGATTCAAGAGACCATCCGAGAAGCATTTGCAGACTGTACC
ATGCTGACCATTGCCCATCGCCTGCACACGGTTCTAGGCTCCGATAGGATTATGGTGCTG
GCCCAGGGACAGGTGGTGGAGTTTGACACCCCATCGGTCCTTCTGTCCAACGACAGTTCC
CGATTCTATGCCATGTTTGCTGCTGCAGAGAACAAGGTCGCTGTCAAGGGCTGA
Protein Properties
Number of Residues 1437
Molecular Weight 160658.8
Theoretical pI 8.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 179-199
  • 219-239
  • 296-316
  • 317-337
  • 400-420
  • 434-454
  • 608-628
  • 848-868
  • 917-937
  • 997-1017
  • 1018-1038
  • 1104-1124
  • 1127-1147
Protein Sequence
>Multidrug resistance-associated protein 5
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLS
LDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLAR
VAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTW
ALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNE
VLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSG
KTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNS
CCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETS
VSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPM
KFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGP
LVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQEL
LDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLT
GLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEM
RYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLE
SEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCT
MLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG
GenBank ID Protein 66529005
UniProtKB/Swiss-Prot ID O15440
UniProtKB/Swiss-Prot Entry Name MRP5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005688.2
GeneCard ID ABCC5
GenAtlas ID ABCC5
HGNC ID HGNC:56
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Belinsky MG, Bain LJ, Balsara BB, Testa JR, Kruh GD: Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins. J Natl Cancer Inst. 1998 Nov 18;90(22):1735-41. [PubMed:9827529 ]
  4. Kool M, de Haas M, Scheffer GL, Scheper RJ, van Eijk MJ, Juijn JA, Baas F, Borst P: Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines. Cancer Res. 1997 Aug 15;57(16):3537-47. [PubMed:9270026 ]
  5. McAleer MA, Breen MA, White NL, Matthews N: pABC11 (also known as MOAT-C and MRP5), a member of the ABC family of proteins, has anion transporter activity but does not confer multidrug resistance when overexpressed in human embryonic kidney 293 cells. J Biol Chem. 1999 Aug 13;274(33):23541-8. [PubMed:10438534 ]
  6. Suzuki T, Sasaki H, Kuh HJ, Agui M, Tatsumi Y, Tanabe S, Terada M, Saijo N, Nishio K: Detailed structural analysis on both human MRP5 and mouse mrp5 transcripts. Gene. 2000 Jan 25;242(1-2):167-73. [PubMed:10721709 ]
  7. Wijnholds J, Mol CA, van Deemter L, de Haas M, Scheffer GL, Baas F, Beijnen JH, Scheper RJ, Hatse S, De Clercq E, Balzarini J, Borst P: Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs. Proc Natl Acad Sci U S A. 2000 Jun 20;97(13):7476-81. [PubMed:10840050 ]
  8. Suzuki T, Nishio K, Sasaki H, Kurokawa H, Saito-Ohara F, Ikeuchi T, Tanabe S, Terada M, Saijo N: cDNA cloning of a short type of multidrug resistance protein homologue, SMRP, from a human lung cancer cell line. Biochem Biophys Res Commun. 1997 Sep 29;238(3):790-4. [PubMed:9325169 ]