You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Hematopoietic cell signal transducer (HMDBP03981)
Identification | |
---|---|
HMDB Protein ID | HMDBP03981 |
Secondary Accession Numbers |
|
Name | Hematopoietic cell signal transducer |
Synonyms |
|
Gene Name | HCST |
Protein Type | Unknown |
Biological Properties | |
General Function | Not Available |
Specific Function | Transmembrane adapter protein which associates with NKG2D to form an activation receptor NKG2D-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with NKG2D-DAP10 triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full NKG2D-HCST-mediated activation and ultimate killing of target cells. In NK cells, NKG2D-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T cells, it provides primarily costimulation for TCR-induced signals. NKG2D-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express NKG2D ligands escape from immune surveillance mediated by NK cells |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location |
|
Gene Properties | |
Chromosome Location | Chromosome:1 |
Locus | 19q13.1 |
SNPs | HCST |
Gene Sequence |
>282 bp ATGATCCATCTGGGTCACATCCTCTTCCTGCTTTTGCTCCCAGTGGCTGCAGCTCAGACG ACTCCAGGAGAGAGATCATCACTCCCTGCCTTTTACCCTGGCACTTCAGGCTCTTGTTCC GGATGTGGGTCCCTCTCTCTGCCGCTCCTGGCAGGCCTCGTGGCTGCTGATGCGGTGGCA TCGCTGCTCATCGTGGGGGCGGTGTTCCTGTGCGCACGCCCACGCCGCAGCCCCGCCCAA GAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCTGA |
Protein Properties | |
Number of Residues | 93 |
Molecular Weight | 9489.0 |
Theoretical pI | 8.51 |
Pfam Domain Function |
|
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Hematopoietic cell signal transducer MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG |
External Links | |
GenBank ID Protein | 15826850 |
UniProtKB/Swiss-Prot ID | Q9UBK5 |
UniProtKB/Swiss-Prot Entry Name | HCST_HUMAN |
PDB IDs | Not Available |
GenBank Gene ID | NM_014266.3 |
GeneCard ID | HCST |
GenAtlas ID | HCST |
HGNC ID | HGNC:16977 |
References | |
General References |
|