You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04309
Secondary Accession Numbers
  • 9898
Name Solute carrier family 22 member 3
Synonyms
  1. EMT
  2. Extraneuronal monoamine transporter
  3. Organic cation transporter 3
Gene Name SLC22A3
Protein Type Transporter
Biological Properties
General Function Involved in transmembrane transport
Specific Function Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain
Pathways
  • Lamivudine Metabolism Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:6
Locus 6q25.3
SNPs SLC22A3
Gene Sequence
>1671 bp
ATGCCCTCCTTCGACGAGGCGCTGCAGCGGGTGGGCGAGTTCGGGCGCTTCCAGAGGCGC
GTGTTTTTGCTGCTGTGCCTGACGGGCGTCACCTTCGCCTTCCTCTTCGTCGGCGTGGTC
TTCCTGGGCACGCAGCCCGACCACTACTGGTGCCGCGGGCCAAGTGCCGCGGCGCTGGCC
GAGCGCTGCGGCTGGAGCCCGGAGGAGGAGTGGAACCGCACGGCGCCCGCCTCCCGCGGC
CCAGAGCCCCCCGAGCGCCGCGGCCGCTGCCAGCGCTACCTCCTGGAGGCGGCCAACGAC
AGCGCCTCCGCCACTAGCGCTCTCAGCTGCGCGGACCCACTCGCCGCCTTCCCCAACCGT
TCGGCTCCCCTTGTGCCGTGCCGCGGCGGCTGGCGCTACGCCCAGGCCCACTCCACCATC
GTCAGCGAGTTTGACCTTGTCTGTGTCAATGCGTGGATGCTGGACCTCACCCAAGCCATC
CTGAACCTCGGCTTCCTGACTGGAGCATTCACCTTAGGCTATGCAGCAGACAGGTATGGC
AGGATCGTCATTTACTTGCTATCCTGCCTTGGTGTTGGCGTCACTGGGGTTGTGGTGGCC
TTTGCACCAAACTTCCCTGTGTTTGTGATCTTCCGCTTCCTGCAAGGTGTATTTGGAAAG
GGGACGTGGATGACTTGCTACGTGATTGTGACAGAAATAGTAGGTTCGAAACAAAGGAGG
ATTGTGGGAATCGTGATTCAAATGTTCTTTACCCTTGGAATCATAATTCTCCCTGGAATT
GCCTACTTCATCCCCAACTGGCAAGGAATCCAGTTAGCCATCACGCTGCCCAGCTTTCTC
TTCCTCCTTTATTACTGGGTGGTCCCTGAGTCTCCCCGTTGGCTGATTACTCGGAAGAAA
GGAGATAAAGCATTACAGATCCTGAGACGCATTGCTAAGTGCAATGGGAAATACCTCTCA
TCAAATTACTCAGAGATCACTGTTACAGATGAGGAAGTTAGTAATCCATCCTTTTTAGAT
CTGGTGAGAACTCCCCAAATGAGGAAATGCACACTTATTCTTATGTTTGCTTGGTTCACA
AGCGCAGTGGTGTATCAAGGACTTGTCATGCGCCTGGGAATTATAGGGGGCAACCTCTAT
ATAGACTTTTTCATCTCGGGCGTGGTGGAACTGCCAGGAGCTCTCTTGATCTTACTAACC
ATTGAGCGCCTTGGACGACGCCTCCCCTTTGCGGCAAGCAATATAGTGGCAGGGGTGGCA
TGCCTTGTCACTGCGTTCTTACCAGAAGGAATAGCATGGTTGAGGACCACAGTGGCTACA
TTGGGAAGACTAGGGATAACCATGGCCTTTGAAATTGTTTATTTGGTAAATTCAGAATTG
TACCCAACAACATTACGAAATTTCGGAGTTTCGCTCTGTTCAGGTCTGTGTGATTTTGGG
GGAATCATAGCCCCATTTCTGCTCTTTCGGCTAGCAGCCGTGTGGCTAGAACTACCTCTG
ATCATCTTTGGTATCCTGGCATCCATCTGTGGTGGCCTTGTGATGCTTTTGCCTGAAACC
AAGGGTATTGCCTTGCCAGAGACAGTGGATGATGTAGAAAAACTTGGCAGTCCACATTCC
TGTAAATGTGGCAGGAATAAGAAAACCCCAGTTTCCCGCTCTCACCTTTGA
Protein Properties
Number of Residues 556
Molecular Weight 61279.5
Theoretical pI 8.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 21-41
  • 182-202
  • 241-261
  • 269-289
  • 381-401
  • 468-488
  • 498-518
Protein Sequence
>Solute carrier family 22 member 3
MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
CKCGRNKKTPVSRSHL
GenBank ID Protein 3581982
UniProtKB/Swiss-Prot ID O75751
UniProtKB/Swiss-Prot Entry Name S22A3_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ001417
GeneCard ID SLC22A3
GenAtlas ID SLC22A3
HGNC ID HGNC:10967
References
General References
  1. Grundemann D, Schechinger B, Rappold GA, Schomig E: Molecular identification of the corticosterone-sensitive extraneuronal catecholamine transporter. Nat Neurosci. 1998 Sep;1(5):349-51. [PubMed:10196521 ]
  2. Verhaagh S, Schweifer N, Barlow DP, Zwart R: Cloning of the mouse and human solute carrier 22a3 (Slc22a3/SLC22A3) identifies a conserved cluster of three organic cation transporters on mouse chromosome 17 and human 6q26-q27. Genomics. 1999 Jan 15;55(2):209-18. [PubMed:9933568 ]
  3. Wu X, Huang W, Ganapathy ME, Wang H, Kekuda R, Conway SJ, Leibach FH, Ganapathy V: Structure, function, and regional distribution of the organic cation transporter OCT3 in the kidney. Am J Physiol Renal Physiol. 2000 Sep;279(3):F449-58. [PubMed:10966924 ]