You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05548
Secondary Accession Numbers
  • 11147
Name Large neutral amino acids transporter small subunit 4
Synonyms
  1. L-type amino acid transporter 4
  2. Solute carrier family 43 member 2
Gene Name SLC43A2
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids
Pathways Not Available
Reactions Not Available
GO Classification
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.3
SNPs SLC43A2
Gene Sequence
>1710 bp
ATGGCGCCCACCCTGGCCACTGCCCATCGGCGCCGCTGGTGGATGGCCTGCACGGCCGTG
CTGGAGAACCTCCTCTTCTCGGCAGTCCTCCTGGGCTGGGGCTCGCTGCTCATCATGCTC
AAGTCAGAGGGCTTTTACTCCTACCTGTGTACCGAGCCAGAGAATGTCACCAATGGCACA
GTGGGCGGCACAGCAGAGCCGGGGCACGAGGAGGTGAGCTGGATGAACGGCTGGCTCAGC
TGCCAGGCCCAGGACGAGATGCTAAATTTGGCCTTCACTGTGGGCTCCTTTCTGCTCAGT
GCCATCACCCTGCCCCTGGGTATCGTCATGGACAAGTATGGCCCGAGGAAGCTCAGGCTG
CTGGGCAGCGCCTGCTTCGCGGTTTCCTGCTTGCTGATTGCGTACGGAGCAAGTAAACCA
AACGCTCTCTCCGTGCTCATCTTCATCGCCCTGGCTCTGAATGGCTTTGGTGGGATGTGT
ATGACCTTCACCTCATTAACACTGCCCAACATGTTCGGCGACCTTCGGTCCACGTTTATT
GCCTTGATGATTGGGTCCTACGCCTCCTCGGCAGTCACCTTTCCAGGAATCAAGCTCATC
TATGATGCTGGTGTCTCCTTCATCGTCGTCCTCGTGGTCTGGGCCGGCTGCTCCGGGCTG
GTTTTCCTCAACTGCTTCTTTAACTGGCCCCTTGAGCCCTTCCCGGGGCCGGAGGACATG
GACTACTCGGTGAAGATCAAGTTCAGCTGGCTGGGCTTTGACCACAAGATCACAGGGAAG
CAGTTCTACAAGCAGGTGACCACGGTGGGCCGGCGCCTGAGTGTGGGCAGCTCCATGAGG
AGTGCCAAGGAGCAGGTGGCGCTGCAGGAGGGCCACAAGCTGTGCCTGTCCACCGTCGAC
CTGGAGGTGAAGTGCCAGCCGGATGCCGCAGTGGCCCCCTCCTTCATGCACAGCGTGTTC
AGCCCCATCCTGCTGCTCAGCCTGGTCACCATGTGCGTCACGCAGCTGCGGCTCATCTTC
TACATGGGGGCTATGAACAACATCCTCAAGTTCCTGGTCAGCGGCGACCAGAAGACAGTT
GGCCTCTACACCTCCATCTTCGGCGTGCTCCAGCTGCTGTGCCTGCTGACGGCCCCCGTC
ATTGGCTACATCATGGACTGGAGGCTGAAGGAGTGTGAAGACGCCTCCGAGGAGCCCGAG
GAGAAAGACGCCAACCAAGGCGAGAAGAAAAAGAAGAAGCGGGACCGGCAGATCCAGAAG
ATCACTAATGCCATGCGGGCCTTCGCCTTCACCAACCTGCTGCTCGTGGGCTTTGGGGTG
ACCTGCCTCATTCCCAACCTGCCTCTCCAGATCCTCTCCTTCATCCTGCACACAATCGTG
CGAGGATTCATCCACTCCGCTGTCGGGGGCCTGTACGCTGCCGTGTACCCCTCCACCCAG
TTCGGCAGCCTCACGGGACTGCAGTCTCTGATCAGCGCGCTCTTCGCCCTTCTGCAGCAG
CCGCTGTTTCTGGCCATGATGGGTCCTCTCCAGGGAGACCCTCTGTGGGTGAACGTGGGG
CTGCTCCTTCTCAGCCTGCTGGGCTTCTGCCTCCCGCTCTACCTGATCTGCTACCGGCGC
CAGCTGGAGCGGCAGCTGCAGCAGAGGCAGGAGGATGACAAACTCTTCCTCAAAATCAAC
GGCTCGTCCAACCAGGAGGCCTTCGTGTAG
Protein Properties
Number of Residues 569
Molecular Weight 62746.3
Theoretical pI 8.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 20-40
  • 90-110
  • 120-140
  • 143-163
  • 177-197
  • 203-223
  • 323-345
  • 365-385
  • 435-455
  • 462-482
  • 490-510
  • 516-536
Protein Sequence
>Large neutral amino acids transporter small subunit 4
MAPTLATAHRRRWWMACTAVLENLLFSAVLLGWGSLLIMLKSEGFYSYLCTEPENVTNGT
VGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLSAITLPLGIVMDKYGPRKLRL
LGSACFAVSCLLIAYGASKPNALSVLIFIALALNGFGGMCMTFTSLTLPNMFGDLRSTFI
ALMIGSYASSAVTFPGIKLIYDAGVSFIVVLVVWAGCSGLVFLNCFFNWPLEPFPGPEDM
DYSVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMRSAKEQVALQEGHKLCLSTVD
LEVKCQPDAAVAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILKFLVSGDQKTV
GLYTSIFGVLQLLCLLTAPVIGYIMDWRLKECEDASEEPEEKDANQGEKKKKKRDRQIQK
ITNAMRAFAFTNLLLVGFGVTCLIPNLPLQILSFILHTIVRGFIHSAVGGLYAAVYPSTQ
FGSLTGLQSLISALFALLQQPLFLAMMGPLQGDPLWVNVGLLLLSLLGFCLPLYLICYRR
QLERQLQQRQEDDKLFLKINGSSNQEAFV
GenBank ID Protein 22748751
UniProtKB/Swiss-Prot ID Q8N370
UniProtKB/Swiss-Prot Entry Name LAT4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_152346.1
GeneCard ID SLC43A2
GenAtlas ID SLC43A2
HGNC ID HGNC:23087
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]
  5. Bodoy S, Martin L, Zorzano A, Palacin M, Estevez R, Bertran J: Identification of LAT4, a novel amino acid transporter with system L activity. J Biol Chem. 2005 Mar 25;280(12):12002-11. Epub 2005 Jan 19. [PubMed:15659399 ]