You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05558
Secondary Accession Numbers
  • 11157
Name Solute carrier organic anion transporter family member 2A1
Synonyms
  1. PGT
  2. Prostaglandin transporter
  3. Solute carrier family 21 member 2
Gene Name SLCO2A1
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function May mediate the release of newly synthesized prostaglandins from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Transports PGD2, as well as PGE1, PGE2 and PGF2A
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
intrinsic to membrane
integral to membrane
cell
Function
transporter activity
Process
transport
physiological process
cellular physiological process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21
SNPs SLCO2A1
Gene Sequence
>1932 bp
ATGGGGCTCCTGCCCAAGCTCGGCGTGTCCCAGGGCAGCGACACCTCTACTAGCCGAGCC
GGCCGCTGTGCCCGCTCGGTCTTCGGCAACATTAAGGTGTTTGTGCTCTGCCAAGGCCTC
CTGCAGCTCTGCCAACTCCTGTACAGCGCCTACTTCAAGAGCAGCCTCACCACCATTGAG
AAGCGCTTTGGGCTCTCCAGTTCTTCATCGGGTCTCATTTCCAGCTTGAATGAGATCAGC
AATGCCATCCTCATCATCTTTGTCAGCTACTTTGGCAGCCGGGTGCACCGTCCACGTCTG
ATTGGCATCGGAGGTCTCTTCCTGGCTGCAGGTGCCTTCATCCTCACCCTCCCACACTTC
CTCTCCGAGCCCTACCAGTACACCTTGGCCAGCACTGGGAACAACAGCCGCTTGCAGGCC
GAGCTCTGCCAGAAGCATTGGCAGGACCTGCCTCCCAGTAAGTGCCACAGCACCACCCAG
AACCCCCAGAAGGAGACCAGCAGCATGTGGGGCCTGATGGTGGTTGCCCAGCTGCTGGCT
GGCATCGGGACAGTGCCTATTCAGCCATTTGGGATCTCCTATGTGGATGACTTCTCAGAG
CCCAGCAACTCGCCCCTGTACATCTCCATCTTATTTGCCATCTCTGTATTTGGACCGGCT
TTCGGGTACCTGCTGGGCTCTATCATGCTGCAGATCTTTGTGGACTATGGCAGGGTCAAC
ACAGCTGCAGTTAACTTGGTCCCGGGTGACCCCCGATGGATTGGAGCCTGGTGGCTAGGC
CTGCTCATTTCTTCAGCTTTATTGGTTCTCACCTCTTTCCCCTTTTTTTTCTTCCCTCGA
GCAATGCCCATAGGAGCAAAGAGGGCTCCTGCCACAGCAGATGAAGCAAGGAAGTTGGAG
GAGGCCAAGTCAAGAGGCTCCCTGGTGGATTTCATTAAACGGTTTCCATGCATCTTTCTG
AGGCTCCTGATGAACTCACTCTTCGTCCTGGTGGTCCTGGCCCAGTGCACCTTCTCCTCC
GTCATTGCTGGCCTCTCCACCTTCCTCAACAAGTTCCTGGAGAAGCAGTATGGCACCTCA
GCAGCCTATGCCAACTTCCTCATTGGTGCTGTGAACCTCCCTGCTGCAGCCTTGGGGATG
CTGTTTGGAGGAATCCTCATGAAGCGCTTTGTTTTCTCTCTACAAACCATTCCCCGCATA
GCTACCACCATCATCACCATCTCCATGATCCTTTGTGTTCCTTTGTTCTTCATGGGATGC
TCCACCCCAACTGTGGCCGAAGTCTACCCCCCTAGCACATCAAGTTCTATACATCCGCAG
TCTCCTGCCTGCCGCAGGGACTGCTCGTGCCCAGATTCTATCTTCCACCCGGTCTGTGGA
GACAATGGAATCGAGTACCTCTCCCCTTGCCATGCCGGCTGCAGCAACATCAACATGAGC
TCTGCAACCTCCAAGCAACTGATCTATTTGAACTGCAGCTGTGTGACCGGGGGATCCGCT
TCAGCAAAGACAGGATCGTGCCCTGTCCCCTGTGCCCACTTCCTGCTCCCGGCCATCTTC
CTCATCTCCTTCGTGTCCCTGATAGCCTGCATCTCCCACAACCCCCTCTACATGATGGTT
CTGCGTGTGGTGAACCAGGAGGAAAAGTCATTTGCCATCGGGGTGCAGTTCTTGTTGATG
CGCTTGCTGGCCTGGCTGCCATCTCCAGCCCTCTATGGCCTCACCATTGACCACTCCTGC
ATCCGGTGGAACTCGCTGTGCTTGGGGAGGCGAGGGGCCTGCGCCTACTATGACAACGAT
GCTCTCCGAGACAGGTACCTGGGCCTGCAGATGGGCTACAAGGCGCTGGGCATGCTGCTG
CTTTGCTTCATCAGCTGGAGGGTGAAGAAGAACAAGGAGTACAACGTGCAGAAGGCGGCA
GGCCTCATCTGA
Protein Properties
Number of Residues 643
Molecular Weight 70117.0
Theoretical pI Not Available
Pfam Domain Function
Signals
  • 1-334
Transmembrane Regions
  • 27-47
  • 71-91
  • 101-121
  • 172-192
  • 210-230
  • 258-278
  • 328-348
  • 366-386
  • 400-420
  • 511-531
  • 551-571
  • 606-626
Protein Sequence
>Solute carrier organic anion transporter family member 2A1
MGLLPKLGVSQGSDTSTSRAGRCARSVFGNIKVFVLCQGLLQLCQLLYSAYFKSSLTTIE
KRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVHRPRLIGIGGLFLAAGAFILTLPHF
LSEPYQYTLASTGNNSRLQAELCQKHWQDLPPSKCHSTTQNPQKETSSMWGLMVVAQLLA
GIGTVPIQPFGISYVDDFSEPSNSPLYISILFAISVFGPAFGYLLGSIMLQIFVDYGRVN
TAAVNLVPGDPRWIGAWWLGLLISSALLVLTSFPFFFFPRAMPIGAKRAPATADEARKLE
EAKSRGSLVDFIKRFPCIFLRLLMNSLFVLVVLAQCTFSSVIAGLSTFLNKFLEKQYGTS
AAYANFLIGAVNLPAAALGMLFGGILMKRFVFSLQTIPRIATTIITISMILCVPLFFMGC
STPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS
SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMV
LRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDND
ALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI
GenBank ID Protein 1617590
UniProtKB/Swiss-Prot ID Q92959
UniProtKB/Swiss-Prot Entry Name SO2A1_HUMAN
PDB IDs Not Available
GenBank Gene ID U70867
GeneCard ID SLCO2A1
GenAtlas ID SLCO2A1
HGNC ID HGNC:10955
References
General References
  1. Lu R, Kanai N, Bao Y, Schuster VL: Cloning, in vitro expression, and tissue distribution of a human prostaglandin transporter cDNA(hPGT). J Clin Invest. 1996 Sep 1;98(5):1142-9. [PubMed:8787677 ]
  2. Lu R, Schuster VL: Molecular cloning of the gene for the human prostaglandin transporter hPGT: gene organization, promoter activity, and chromosomal localization. Biochem Biophys Res Commun. 1998 May 29;246(3):805-12. [PubMed:9618293 ]