You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05566
Secondary Accession Numbers
  • 11165
Name Prostaglandin E synthase 2
Synonyms
  1. Microsomal prostaglandin E synthase 2
  2. Prostaglandin E synthase 2 truncated form
  3. mPGES-2
Gene Name PTGES2
Protein Type Enzyme
Biological Properties
General Function Involved in electron carrier activity
Specific Function Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
Pathways
  • Arachidonic acid metabolism
  • prostaglandin biosynthesis
Reactions
(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate → (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate details
Prostaglandin H2 → Prostaglandin E2 details
GO Classification
Biological Process
cell redox homeostasis
positive regulation of transcription, DNA-dependent
secretion
prostaglandin biosynthetic process
Cellular Component
cytosol
mitochondrion
perinuclear region of cytoplasm
nucleus
integral to membrane
Golgi membrane
Function
catalytic activity
electron carrier activity
oxidoreductase activity, acting on a sulfur group of donors
disulfide oxidoreductase activity
protein disulfide oxidoreductase activity
oxidoreductase activity
Molecular Function
prostaglandin-E synthase activity
electron carrier activity
protein disulfide oxidoreductase activity
DNA binding
Process
cellular process
cellular homeostasis
cell redox homeostasis
Cellular Location
  1. perinuclear region
  2. Prostaglandin E synthase 2 truncated form:Cytoplasm
Gene Properties
Chromosome Location 9
Locus 9q34.11
SNPs PTGES2
Gene Sequence
>1134 bp
ATGGACCCGGCTGCGCGGGTGGTGCGGGCGCTGTGGCCTGGTGGGTGCGCCTTGGCCTGG
AGGCTGGGAGGCCGCCCCCAGCCGCTGCTACCCACGCAGAGCCGGGCTGGCTTCGCGGGG
GCGGCGGGCGGCCCGAGCCCCGTGGCTGCAGCTCGTAAGGGGAGCCCGCGGCTGCTGGGA
GCTGCGGCGCTGGCCCTGGGGGGAGCCCTGGGGCTGTACCACACGGCGCGGTGGCACCTG
CGCGCCCAGGACCTCCACGCAGAGCGCTCAGCCGCGCAGCTCTCCCTGTCCAGCCGCCTG
CAGCTGACCCTGTACCAGTACAAGACGTGTCCCTTCTGCAGCAAGGTCCGAGCCTTCCTC
GACTTCCATGCCCTGCCCTACCAGGTGGTGGAGGTGAACCCTGTGCGCAGGGCTGAGATC
AAGTTCTCCTCCTACAGAAAGGTGCCCATCCTGGTGGCCCAGGAAGGAGAAAGCTCGCAA
CAACTAAATGACTCCTCTGTCATCATCAGCGCCCTCAAGACCTACCTGGTGTCGGGGCAG
CCCCTGGAAGAGATCATCACCTACTACCCAGCCATGAAGGCTGTGAACGAGCAGGGCAAG
GAGGTGACCGAGTTCGGCAATAAGTACTGGCTCATGCTCAACGAGAAGGAGGCCCAGCAA
GTGTATGGTGGGAAGGAGGCCAGGACGGAGGAGATGAAGTGGCGGCAGTGGGCGGACGAC
TGGCTGGTGCACCTGATCTCCCCCAATGTGTACCGCACGCCCACCGAGGCTCTGGCGTCC
TTTGACTACATTGTCCGCGAGGGCAAGTTCGGAGCCGTGGAGGGTGCCGTGGCCAAGTAC
ATGGGTGCAGCGGCCATGTACCTCATCAGCAAGCGACTCAAGAGCAGGCACCGCCTCCAG
GACAACGTGCGCGAGGACCTCTATGAGGCTGCTGACAAGTGGGTGGCTGCTGTGGGCAAG
GACCGGCCCTTCATGGGGGGCCAGAAGCCGAATCTCGCTGATTTGGCGGTGTATGGCGTG
CTGCGTGTGATGGAGGGGCTGGATGCATTCGATGACCTGATGCAGCACACGCACATCCAG
CCCTGGTACCTGCGGGTGGAGAGGGCCATCACCGAGGCCTCCCCAGCGCACTGA
Protein Properties
Number of Residues 377
Molecular Weight 21337.205
Theoretical pI 6.703
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Prostaglandin E synthase 2
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
GenBank ID Protein 10436397
UniProtKB/Swiss-Prot ID Q9H7Z7
UniProtKB/Swiss-Prot Entry Name PGES2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK024100
GeneCard ID PTGES2
GenAtlas ID PTGES2
HGNC ID HGNC:17822
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Tanikawa N, Ohmiya Y, Ohkubo H, Hashimoto K, Kangawa K, Kojima M, Ito S, Watanabe K: Identification and characterization of a novel type of membrane-associated prostaglandin E synthase. Biochem Biophys Res Commun. 2002 Mar 8;291(4):884-9. [PubMed:11866447 ]
  6. Watanabe K, Ohkubo H, Niwa H, Tanikawa N, Koda N, Ito S, Ohmiya Y: Essential 110Cys in active site of membrane-associated prostaglandin E synthase-2. Biochem Biophys Res Commun. 2003 Jun 27;306(2):577-81. [PubMed:12804604 ]
  7. Murakami M, Nakashima K, Kamei D, Masuda S, Ishikawa Y, Ishii T, Ohmiya Y, Watanabe K, Kudo I: Cellular prostaglandin E2 production by membrane-bound prostaglandin E synthase-2 via both cyclooxygenases-1 and -2. J Biol Chem. 2003 Sep 26;278(39):37937-47. Epub 2003 Jun 30. [PubMed:12835322 ]
  8. Lehner B, Sanderson CM: A protein interaction framework for human mRNA degradation. Genome Res. 2004 Jul;14(7):1315-23. [PubMed:15231747 ]