You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05979
Secondary Accession Numbers
  • 11581
Name Neutral alpha-glucosidase C
Synonyms Not Available
Gene Name GANC
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Has alpha-glucosidase activity.
Pathways
  • Galactose metabolism
  • Starch and sucrose metabolism
Reactions
D-Maltose + Water → Alpha-D-Glucose details
Sucrose + Water → D-Fructose + D-Glucose details
Sucrose + Water → D-Fructose + Alpha-D-Glucose details
GO Classification
Biological Process
carbohydrate metabolic process
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
Molecular Function
carbohydrate binding
alpha-glucosidase activity
maltose alpha-glucosidase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GANC
Gene Sequence
>2745 bp
ATGGAAGCAGCAGTGAAAGAGGAAATAAGTCTTGAAGATGAAGCTGTAGATAAAAACATT
TTCAGAGACTGTAACAAGATCGCATTTTACAGGCGTCAGAAACAGTGGCTTTCCAAGAAG
TCCACCTATCAGGCATTATTGGATTCAGTCACAACAGATGAAGACAGCACCAGGTTCCAA
ATCATCAATGAAGCAAGTAAGGTTCCTCTCCTGGCTGAAATTTATGGTATAGAAGGAAAC
ATTTTCAGGCTTAAAATTAATGAAGAGACTCCTCTAAAACCCAGATTTGAAGTTCCGGAT
GTCCTCACAAGCAAGCCAAGCACTGTAAGGCTGATTTCATGCTCTGGGGACACAGGCAGT
CTGATATTGGCAGATGGAAAAGGAGACCTGAAGTGCCATATCACAGCAAACCCATTCAAG
GTAGACTTGGTGTCTGAAGAAGAGGTTGTGATTAGCATAAATTCCCTGGGCCAATTATAC
TTTGAGCATCTACAGATTCTTCACAAACAAAGAGCTGCTAAAGAAAATGAGGAGGAGACA
TCAGTGGACACCTCTCAGGAAAATCAAGAAGATCTGGGCCTGTGGGAAGAGAAATTTGGA
AAATTTGTGGATATCAAAGCTAATGGCCCTTCTTCTATTGGTTTGGATTTCTCCTTGCAT
GGATTTGAGCATCTTTATGGGATCCCACAACATGCAGAATCACACCAACTTAAAAATACT
GGTGATGGAGATGCTTACCGTCTTTATAACCTGGATGTCTATGGATACCAAATATATGAT
AAAATGGGCATTTATGGTTCAGTACCTTATCTCCTGGCCCACAAACTGGGCAGAACTATA
GGTATTTTCTGGCTGAATGCCTCGGAAACACTGGTGGAGATCAATACAGAGCCTGCAGTA
GAGTACACACTGACCCAGATGGGCCCAGTTGCTGCTAAACAAAAGGTCAGATCTCGCACT
CATGTGCACTGGATGTCAGAGAGTGGCATCATTGATGTTTTTCTGCTGACAGGACCTACA
CCTTCTGATGTCTTCAAACAGTACTCACACCTTACAGGCACACAAGCCATGCCCCCTCTT
TTCTCTTTGGGATACCACCAGTGCCGCTGGAACTATGAAGATGAGCAGGATGTAAAAGCA
GTGGATGCAGGGTTTGATGAGCATGACATTCCTTATGATGCCATGTGGCTGGACATAGAG
CACACTGAGGGCAAGAGGTACTTCACCTGGGACAAAAACAGATTCCCAAACCCCAAGAGG
ATGCAAGAGCTGCTCAGGAGCAAAAAGCGTAAGCTTGTGGTCATCAGTGATCCCCACATC
AAGATTGATCCTGACTACTCAGTATATGTGAAGGCCAAAGATCAGGGCTTCTTTGTGAAG
AATCAGGAAGGGGAAGACTTTGAAGGGGTGTGTTGGCCAGGTCTCTCCTCTTACCTGGAT
TTCACCAATCCCAAGGTCAGAGAGTGGTATTCAAGTCTTTTTGCTTTCCCTGTTTATCAG
GGATCTACGGACATCCTCTTCCTTTGGAATGACATGAATGAGCCTTCTGTCTTTAGAGGG
CCAGAGCAAACCATGCAGAAGAATGCCATTCATCATGGCAATTGGGAGCACAGAGAGCTC
CACAACATCTACGGTTTTTATCATCAAATGGCTACTGCAGAAGGACTGATAAAACGATCT
AAAGGGAAGGAGAGACCCTTTGTTCTTACACGTTCTTTCTTTGCTGGATCACAAAAGTAT
GGTGCCGTGTGGACAGGCGACAACACAGCAGAATGGAGCAACTTGAAAATTTCTATCCCA
ATGTTACTCACTCTCAGCATTACTGGGATCTCTTTTTGCGGAGCTGACATAGGCGGGTTC
ATTGGGAATCCAGAGACAGAGCTGCTAGTGCGTTGGTACCAGGCTGGAGCCTACCAGCCC
TTCTTCCGTGGCCATGCCACCATGAACACCAAGCGACGAGAGCCCTGGCTCTTTGGGGAG
GAACACACCCGACTCATCCGAGAAGCCATCAGAGAGCGCTATGGCCTCCTGCCATATTGG
TATTCTCTGTTCTACCATGCACACGTGGCTTCCCAACCTGTCATGAGGCCTCTGTGGGTA
GAGTTCCCTGATGAACTAAAGACTTTTGATATGGAAGATGAATACATGCTGGGGAGTGCA
TTATTGGTTCATCCAGTCACAGAACCAAAAGCCACCACAGTTGATGTGTTTCTTCCAGGA
TCAAATGAGGTCTGGTATGACTATAAGACATTTGCTCATTGGGAAGGAGGGTGTACTGTA
AAGATCCCAGTAGCCTTGGACACTATTCCAGTGTTTCAGCGAGGTGGAAGTGTGATACCA
ATAAAGACAACTGTAGGAAAATCCACAGGCTGGATGACTGAATCCTCCTATGGACTCCGG
GTTGCTCTAAGCACTAAGGGTTCTTCAGTGGGTGAGTTATATCTTGATGATGGCCATTCA
TTCCAATACCTCCACCAGAAGCAATTTTTGCACAGGAAGTTTTCATTCTGTTCCAGTGTT
CTGATCAATAGTTTTGCTGACCAGAGGGGTCATTATCCCAGCAAGTGTGTGGTGGAGAAG
ATCTTGGTCTTAGGCTTCAGGAAGGAGCCATCTTCTGTGACTACCCACTCATCTGATGGT
AAAGATCAGCCTGTGGCTTTTACGTATTGTGCCAAAACATCCATCCTGAGCCTGGAGAAG
CTCTCACTCAACATTGCCACTGACTGGGAGGTCCGCATCATATGA
Protein Properties
Number of Residues 914
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Neutral alpha-glucosidase C
MEAAVKEEISLEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEET
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSFADQRGHYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEK
LSLNIATDWEVRII
GenBank ID Protein 66346737
UniProtKB/Swiss-Prot ID Q8TET4
UniProtKB/Swiss-Prot Entry Name GANC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_198141.2
GeneCard ID GANC
GenAtlas ID GANC
HGNC ID HGNC:4139
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  3. Hirschhorn R, Huie ML, Kasper JS: Computer assisted cloning of human neutral alpha-glucosidase C (GANC): a new paralog in the glycosyl hydrolase gene family 31. Proc Natl Acad Sci U S A. 2002 Oct 15;99(21):13642-6. Epub 2002 Oct 7. [PubMed:12370436 ]