You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06423
Secondary Accession Numbers
  • 12041
Name Uridine phosphorylase 1
Synonyms
  1. UPase 1
  2. UrdPase 1
Gene Name UPP1
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring pentosyl groups
Specific Function Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Pathways
  • Drug metabolism - other enzymes
  • Pyrimidine metabolism
  • UMP biosynthesis via salvage pathway
Reactions
Uridine + Phosphoric acid → Uracil + Ribose 1-phosphate details
Fluorouracil + Ribose 1-phosphate → 5-Fluorouridine + Phosphoric acid details
GO Classification
Biological Process
pyrimidine nucleoside salvage
pyrimidine nucleobase metabolic process
pyrimidine nucleoside catabolic process
UMP salvage
nucleotide catabolic process
uridine metabolic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
uridine phosphorylase activity
catalytic activity
transferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
uridine phosphorylase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleotide catabolic process
nucleoside metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7p12.3
SNPs UPP1
Gene Sequence
>933 bp
ATGGCGGCCACGGGAGCCAATGCAGAGAAAGCTGAAAGTCACAATGATTGCCCCGTCAGA
CTTTTAAATCCAAACATAGCAAAAATGAAAGAAGATATTCTCTATCATTTCAATCTCACC
ACTAGCAGACACAATTTCCCAGCCTTGTTTGGAGATGTGAAGTTTGTGTGTGTTGGTGGA
AGCCCCTCCCGGATGAAAGCCTTCATCAGGTGCGTTGGTGCAGAGCTGGGCCTTGACTGC
CCAGGTAGAGACTATCCCAACATCTGTGCGGGAACTGACCGCTATGCCATGTATAAAGTA
GGACCGGTGCTGTCTGTCAGTCATGGTATGGGCATTCCTTCTATCTCAATCATGTTGCAT
GAGCTCATAAAGCTGCTGTACTATGCCCGGTGCTCCAACGTCACTATCATCCGCATTGGC
ACTTCTGGTGGGATAGGTCTGGAGCCCGGCACTGTGGTCATAACAGAGCAGGCAGTGGAT
ACCTGCTTCAAGGCAGAGTTTGAGCAGATTGTCCTGGGGAAGCGGGTCATCCGGAAAACG
GACCTTAACAAGAAGCTGGTGCAGGAGCTGTTGCTGTGTTCTGCAGAGCTGAGCGAGTTC
ACCACAGTGGTGGGGAACACCATGTGCACCTTGGACTTCTATGAAGGGCAAGGCCGTCTG
GATGGGGCTCTCTGCTCCTACACGGAGAAGGACAAGCAGGCGTATCTGGAGGCAGCCTAT
GCAGCCGGCGTCCGCAATATCGAGATGGAGTCCTCGGTGTTTGCCGCCATGTGCAGCGCC
TGCGGCCTCCAAGCGGCCGTGGTGTGTGTCACCCTCCTGAACCGCCTGGAAGGGGACCAG
ATCAGCAGCCCTCGCAATGTGCTCAGCGAGTACCAGCAGAGGCCGCAGCGGCTGGTGAGC
TACTTCATCAAGAAGAAACTGAGCAAGGCCTGA
Protein Properties
Number of Residues 310
Molecular Weight 33934.005
Theoretical pI 7.886
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Uridine phosphorylase 1
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
GenBank ID Protein 1050525
UniProtKB/Swiss-Prot ID Q16831
UniProtKB/Swiss-Prot Entry Name UPP1_HUMAN
PDB IDs
GenBank Gene ID X90858
GeneCard ID UPP1
GenAtlas ID UPP1
HGNC ID HGNC:12576
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Watanabe S, Uchida T: Cloning and expression of human uridine phosphorylase. Biochem Biophys Res Commun. 1995 Nov 2;216(1):265-72. [PubMed:7488099 ]