You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06424
Secondary Accession Numbers
  • 12042
Name Uridine phosphorylase 2
Synonyms
  1. UPase 2
  2. UrdPase 2
Gene Name UPP2
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring pentosyl groups
Specific Function Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.
Pathways
  • Beta Ureidopropionase Deficiency
  • Dihydropyrimidinase Deficiency
  • Drug metabolism - other enzymes
  • MNGIE (Mitochondrial Neurogastrointestinal Encephalopathy)
  • Pyrimidine Metabolism
  • Pyrimidine metabolism
  • UMP biosynthesis via salvage pathway
  • UMP Synthase Deficiency (Orotic Aciduria)
Reactions
Uridine + Phosphoric acid → Uracil + Ribose 1-phosphate details
Fluorouracil + Ribose 1-phosphate → 5-Fluorouridine + Phosphoric acid details
GO Classification
Biological Process
pyrimidine nucleoside salvage
pyrimidine nucleobase metabolic process
pyrimidine nucleoside catabolic process
UMP salvage
nucleotide catabolic process
uridine metabolic process
Cellular Component
cytosol
type III intermediate filament
Component
cell part
intracellular part
cytoplasm
Function
uridine phosphorylase activity
catalytic activity
transferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
uridine phosphorylase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleotide catabolic process
nucleoside metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q24.1
SNPs UPP2
Gene Sequence
>954 bp
ATGGCTTCAGTTATACCTGCCTCCAATAGGTCCATGAGATCTGACAGGAATACATATGTT
GGAAAAAGGTTTGTTCACGTTAAAAATCCTTACTTGGATTTGATGGATGAAGACATTCTC
TATCACTTGGATTTGGGAACAAAAACACACAACCTACCAGCAATGTTTGGAGATGTAAAG
TTTGTCTGTGTCGGTGGGAGCCCCAACAGAATGAAAGCATTTGCACTGTTTATGCACAAG
GAGCTCGGGTTTGAGGAAGCTGAAGAAGACATAAAAGACATCTGTGCTGGGACAGACAGA
TACTGTATGTACAAAACCGGGCCTGTGCTCGCCATCAGTCACGGCATGGGCATCCCCTCC
ATTTCTATTATGCTTCATGAACTCATCAAATTACTCCACCATGCACGGTGCTGCGATGTC
ACCATTATTAGAATCGGTACATCAGGGGGAATAGGGATTGCACCAGGGACTGTTGTAATA
ACGGATATAGCTGTAGACTCCTTCTTTAAGCCCCGGTTTGAACAGGTCATTTTGGACAAC
ATTGTCACCCGAAGTACTGAACTGGACAAAGAACTGTCTGAAGAACTGTTCAACTGTAGC
AAAGAAATCCCCAACTTCCCAACCCTCGTTGGACATACAATGTGTACCTATGATTTTTAT
GAAGGCCAAGGCCGACTAGATGGAGCACTGTGCTCCTTTTCCAGAGAAAAAAAGTTAGAC
TACTTGAAGAGAGCATTTAAAGCTGGTGTCAGGAATATTGAAATGGAATCTACAGTGTTT
GCAGCTATGTGTGGACTCTGTGGTCTAAAAGCTGCTGTGGTCTGTGTGACACTTCTCGAC
AGACTCGACTGTGATCAGATCAACTTGCCTCATGATGTCCTGGTGGAGTACCAGCAACGG
CCTCAGCTCCTAATCTCCAACTTCATCAGACGGCGGCTTGGACTTTGTGACTAG
Protein Properties
Number of Residues 317
Molecular Weight 41601.795
Theoretical pI 6.4
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Uridine phosphorylase 2
MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVK
FVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPS
ISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDN
IVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLD
YLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR
PQLLISNFIRRRLGLCD
GenBank ID Protein 4204340
UniProtKB/Swiss-Prot ID O95045
UniProtKB/Swiss-Prot Entry Name UPP2_HUMAN
PDB IDs
GenBank Gene ID AC005539
GeneCard ID UPP2
GenAtlas ID UPP2
HGNC ID HGNC:23061
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Johansson M: Identification of a novel human uridine phosphorylase. Biochem Biophys Res Commun. 2003 Jul 18;307(1):41-6. [PubMed:12849978 ]