You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP07035 |
Secondary Accession Numbers
| |
Name
| Cytochrome c oxidase subunit 2 |
Synonyms
|
- Cytochrome c oxidase polypeptide II
|
Gene Name
| MT-CO2 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Involved in copper ion binding |
Specific Function
| Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 |
Pathways
|
Not Available
|
Reactions
| Not Available |
GO Classification
|
Component |
membrane |
cell part |
membrane part |
intrinsic to membrane |
integral to membrane |
Function |
ion binding |
cation binding |
metal ion binding |
binding |
catalytic activity |
transition metal ion binding |
electron carrier activity |
iron ion binding |
heme binding |
oxidoreductase activity |
heme-copper terminal oxidase activity |
cytochrome-c oxidase activity |
copper ion binding |
Process |
metabolic process |
generation of precursor metabolites and energy |
electron transport chain |
respiratory electron transport chain |
cellular metabolic process |
|
Cellular Location
|
- Mitochondrion inner membrane
- Multi-pass membrane protein
|
Gene Properties |
Chromosome Location
| Not Available |
Locus
| Not Available |
SNPs
| MT-CO2 |
Gene Sequence
|
>684 bp
ATGGCACATGCAGCGCAAGTAGGTCTACAAGACGCTACTTCCCCTATCATAGAAGAGCTT
ATCACCTTTCATGATCACGCCCTCATAATCATTTTCCTTATCTGCTTCCTAGTCCTGTAT
GCCCTTTTCCTAACACTCACAACAAAACTAACTAATACTAACATCTCAGACGCTCAGGAA
ATAGAAACCGTCTGAACTATCCTGCCCGCCATCATCCTAGTCCTCATCGCCCTCCCATCC
CTACGCATCCTTTACATAACAGACGAGGTCAACGATCCCTCCCTTACCATCAAATCAATT
GGCCACCAATGGTACTGAACCTACGAGTACACCGACTACGGCGGACTAATCTTCAACTCC
TACATACTTCCCCCATTATTCCTAGAACCAGGCGACCTGCGACTCCTTGACGTTGACAAT
CGAGTAGTACTCCCGATTGAAGCCCCCATTCGTATAATAATTACATCACAAGACGTCTTG
CACTCATGAGCTGTCCCCACATTAGGCTTAAAAACAGATGCAATTCCCGGACGTCTAAAC
CAAACCACTTTCACCGCTACACGACCGGGGGTATACTACGGTCAATGCTCTGAAATCTGT
GGAGCAAACCACAGTTTCATGCCCATCGTCCTAGAATTAATTCCCCTAAAAATCTTTGAA
ATAGGGCCCGTATTTACCCTATAG
|
Protein Properties |
Number of Residues
| 227 |
Molecular Weight
| 25564.7 |
Theoretical pI
| 4.44 |
Pfam Domain Function
|
|
Signals
|
|
Transmembrane Regions
|
|
Protein Sequence
|
>Cytochrome c oxidase subunit 2
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
|
External Links |
GenBank ID Protein
| 12584 |
UniProtKB/Swiss-Prot ID
| P00403 |
UniProtKB/Swiss-Prot Entry Name
| COX2_HUMAN |
PDB IDs
|
Not Available |
GenBank Gene ID
| X15759 |
GeneCard ID
| MT-CO2 |
GenAtlas ID
| MT-CO2 |
HGNC ID
| HGNC:7421 |
References |
General References
| - Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG: Sequence and organization of the human mitochondrial genome. Nature. 1981 Apr 9;290(5806):457-65. [PubMed:7219534 ]
- Horai S, Hayasaka K, Kondo R, Tsugane K, Takahata N: Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. Proc Natl Acad Sci U S A. 1995 Jan 17;92(2):532-6. [PubMed:7530363 ]
- Moilanen JS, Finnila S, Majamaa K: Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J. Mol Biol Evol. 2003 Dec;20(12):2132-42. Epub 2003 Aug 29. [PubMed:12949126 ]
- Ingman M, Kaessmann H, Paabo S, Gyllensten U: Mitochondrial genome variation and the origin of modern humans. Nature. 2000 Dec 7;408(6813):708-13. [PubMed:11130070 ]
- Ingman M, Gyllensten U: Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines. Genome Res. 2003 Jul;13(7):1600-6. [PubMed:12840039 ]
- Coble MD, Just RS, O'Callaghan JE, Letmanyi IH, Peterson CT, Irwin JA, Parsons TJ: Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians. Int J Legal Med. 2004 Jun;118(3):137-46. Epub 2004 Feb 4. [PubMed:14760490 ]
- Marzuki S, Noer AS, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E: Normal variants of human mitochondrial DNA and translation products: the building of a reference data base. Hum Genet. 1991 Dec;88(2):139-45. [PubMed:1757091 ]
- Polyak K, Li Y, Zhu H, Lengauer C, Willson JK, Markowitz SD, Trush MA, Kinzler KW, Vogelstein B: Somatic mutations of the mitochondrial genome in human colorectal tumours. Nat Genet. 1998 Nov;20(3):291-3. [PubMed:9806551 ]
- Power MD, Kiefer MC, Barr PJ, Reeves R: Nucleotide sequence of human mitochondrial cytochrome c oxidase II cDNA. Nucleic Acids Res. 1989 Aug 25;17(16):6734. [PubMed:2550900 ]
- Barrell BG, Bankier AT, Drouin J: A different genetic code in human mitochondria. Nature. 1979 Nov 8;282(5735):189-94. [PubMed:226894 ]
- Ruvolo M, Zehr S, von Dornum M, Pan D, Chang B, Lin J: Mitochondrial COII sequences and modern human origins. Mol Biol Evol. 1993 Nov;10(6):1115-35. [PubMed:8277847 ]
- Rahman S, Taanman JW, Cooper JM, Nelson I, Hargreaves I, Meunier B, Hanna MG, Garcia JJ, Capaldi RA, Lake BD, Leonard JV, Schapira AH: A missense mutation of cytochrome oxidase subunit II causes defective assembly and myopathy. Am J Hum Genet. 1999 Oct;65(4):1030-9. [PubMed:10486321 ]
|