You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07173
Secondary Accession Numbers
  • 12792
Name Ribulose-phosphate 3-epimerase
Synonyms
  1. Ribulose-5-phosphate-3-epimerase
Gene Name RPE
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
Pathways
  • Glucose-6-phosphate dehydrogenase deficiency
  • Pentose and glucuronate interconversions
  • Pentose Phosphate Pathway
  • Pentose phosphate pathway
  • Ribose-5-phosphate isomerase deficiency
  • Transaldolase deficiency
Reactions
D-Ribulose 5-phosphate → Xylulose 5-phosphate details
GO Classification
Biological Process
pentose-phosphate shunt
Cellular Component
cytosol
Function
catalytic activity
racemase and epimerase activity
racemase and epimerase activity, acting on carbohydrates and derivatives
ribulose-phosphate 3-epimerase activity
isomerase activity
Molecular Function
ribulose-phosphate 3-epimerase activity
metal ion binding
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q32-q33.3
SNPs RPE
Gene Sequence
>687 bp
ATGGCGTCGGGCTGCAAGATTGGCCCGTCCATCCTCAACAGCGACCTGGCCAATTTAGGG
GCCGAGTGCCTCCGGATGCTAGACTCTGGGGCCGATTATCTGCACCTGGACGTAATGGAC
GGGCATTTTGTTCCCAACATCACCTTTGGTCACCCTGTGGTAGAAAGCCTTCGAAAGCAG
CTAGGCCAGGACCCTTTCTTTGACATGCACATGATGGTGTCCAAGCCAGAACAGTGGGTA
AAGCCAATGGCTGTAGCAGGAGCCAATCAGTACACCTTTCATCTCGAGGCTACTGAGAAC
CCAGGGGCTTTGATTAAAGACATTCGGGAGAATGGGATGAAGGTTGGCCTTGCCATCAAA
CCAGGAACCTCAGTTGAGTATTTGGCACCATGGGCTAATCAGATAGATATGGCCTTGGTT
ATGACAGTGGAACCGGGGTTTGGAGGGCAGAAATTCATGGAAGATATGATGCCAAAGGTT
CACTGGTTGAGGACCCAGTTCCCATCTTTGGATATAGAGGTCGATGGTGGAGTAGGTCCT
GACACTGTCCATAAATGTGCAGAGGCAGGAGCTAACATGATTGTGTCTGGCAGTGCTATT
ATGAGGAGTGAAGACCCCAGATCTGTGATCAATCTATTAAGAAATGTTTGCTCAGAAGCT
GCTCAGAAACGTTCTCTTGATCGGTGA
Protein Properties
Number of Residues 228
Molecular Weight 19537.385
Theoretical pI 6.083
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ribulose-phosphate 3-epimerase
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
GenBank ID Protein 40385883
UniProtKB/Swiss-Prot ID Q96AT9
UniProtKB/Swiss-Prot Entry Name RPE_HUMAN
PDB IDs
GenBank Gene ID NM_199229.1
GeneCard ID RPE
GenAtlas ID RPE
HGNC ID HGNC:10293
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Stanchi F, Bertocco E, Toppo S, Dioguardi R, Simionati B, Cannata N, Zimbello R, Lanfranchi G, Valle G: Characterization of 16 novel human genes showing high similarity to yeast sequences. Yeast. 2001 Jan 15;18(1):69-80. [PubMed:11124703 ]