Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07253
Secondary Accession Numbers
  • 12872
Name A disintegrin and metalloproteinase with thrombospondin motifs 1
Synonyms
  1. ADAM-TS 1
  2. ADAM-TS1
  3. ADAMTS-1
  4. METH-1
Gene Name ADAMTS1
Protein Type Unknown
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
proteinaceous extracellular matrix
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:2
Locus 21q21.2
SNPs ADAMTS1
Gene Sequence
>2904 bp
ATGCAGCGAGCTGTGCCCGAGGGGTTCGGAAGGCGCAAGCTGGGCAGCGACATGGGGAAC
GCGGAGCGGGCTCCGGGGTCTCGGAGCTTTGGGCCCGTACCCACGCTGCTGCTGCTCGCC
GCGGCGCTACTGGCCGTGTCGGACGCACTCGGGCGCCCCTCCGAGGAGGACGAGGAGCTA
GTGGTGCCGGAGCTGGAGCGCGCCCCGGGACACGGGACCACGCGCCTCCGCCTGCACGCC
TTTGACCAGCAGCTGGATCTGGAGCTGCGGCCCGACAGCAGCTTTTTGGCGCCCGGCTTC
ACGCTCCAGAACGTGGGGCGCAAATCCGGGTCCGAGACGCCGCTTCCGGAAACCGACCTG
GCGCACTGCTTCTACTCCGGCACCGTGAATGGCGATCCCAGCTCGGCTGCCGCCCTCAGC
CTCTGCGAGGGCGTGCGCGGCGCCTTCTACCTGCTGGGGGAGGCGTATTTCATCCAGCCG
CTGCCCGCCGCCAGCGAGCGCCTCGCCACCGCCGCCCCAGGGGAGAAGCCGCCGGCACCA
CTACAGTTCCACCTCCTGCGGCGGAATCGGCAGGGCGACGTCGGCGGCACGTGCGGGGTC
GTGGACGACGAGCCCCGGCCGACTGGGAAAGCGGAGACCGAAGACGAGGACGAAGGGACT
GAGGGCGAGGACGAAGGGGCTCAGTGGTCGCCGCAGGACCCGGCACTGCAAGGCGTAGGA
CAGCCCACAGGAACTGGAAGCATAAGAAAGAAGCGATTTGTGTCCAGTCACCGCTATGTG
GAAACCATGCTTGTGGCAGACCAGTCGATGGCAGAATTCCACGGCAGTGGTCTAAAGCAT
TACCTTCTCACGTTGTTTTCGGTGGCAGCCAGATTGTACAAACACCCCAGCATTCGTAAT
TCAGTTAGCCTGGTGGTGGTGAAGATCTTGGTCATCCACGATGAACAGAAGGGGCCGGAA
GTGACCTCCAATGCTGCCCTCACTCTGCGGAACTTTTGCAACTGGCAGAAGCAGCACAAC
CCACCCAGTGACCGGGATGCAGAGCACTATGACACAGCAATTCTTTTCACCAGACAGGAC
TTGTGTGGGTCCCAGACATGTGATACTCTTGGGATGGCTGATGTTGGAACTGTGTGTGAT
CCGAGCAGAAGCTGCTCCGTCATAGAAGATGATGGTTTACAAGCTGCCTTCACCACAGCC
CATGAATTAGGCCACGTGTTTAACATGCCACATGATGATGCAAAGCAGTGTGCCAGCCTT
AATGGTGTGAACCAGGATTCCCACATGATGGCGTCAATGCTTTCCAACCTGGACCACAGC
CAGCCTTGGTCTCCTTGCAGTGCCTACATGATTACATCATTTCTGGATAATGGTCATGGG
GAATGTTTGATGGACAAGCCTCAGAATCCCATACAGCTCCCAGGCGATCTCCCTGGCACC
TCGTACGATGCCAACCGGCAGTGCCAGTTTACATTTGGGGAGGACTCCAAACACTGCCCC
GATGCAGCCAGCACATGTAGCACCTTGTGGTGTACCGGCACCTCTGGTGGGGTGCTGGTG
TGTCAAACCAAACACTTCCCGTGGGCGGATGGCACCAGCTGTGGAGAAGGGAAATGGTGT
ATCAACGGCAAGTGTGTGAACAAAACCGACAGAAAGCATTTTGATACGCCTTTTCATGGA
AGCTGGGGAATGTGGGGGCCTTGGGGAGACTGTTCGAGAACGTGCGGTGGAGGAGTCCAG
TACACGATGAGGGAATGTGACAACCCAGTCCCAAAGAATGGAGGGAAGTACTGTGAAGGC
AAACGAGTGCGCTACAGATCCTGTAACCTTGAGGACTGTCCAGACAATAATGGAAAAACC
TTTAGAGAGGAACAATGTGAAGCACACAACGAGTTTTCAAAAGCTTCCTTTGGGAGTGGG
CCTGCGGTGGAATGGATTCCCAAGTACGCTGGCGTCTCACCAAAGGACAGGTGCAAGCTC
ATCTGCCAAGCCAAAGGCATTGGCTACTTCTTCGTTTTGCAGCCCAAGGTTGTAGATGGT
ACTCCATGTAGCCCAGATTCCACCTCTGTCTGTGTGCAAGGACAGTGTGTAAAAGCTGGT
TGTGATCGCATCATAGACTCCAAAAAGAAGTTTGATAAATGTGGTGTTTGCGGGGGAAAT
GGATCTACTTGTAAAAAAATATCAGGATCAGTTACTAGTGCAAAACCTGGATATCATGAT
ATCATCACAATTCCAACTGGAGCCACCAACATCGAAGTGAAACAGCGGAACCAGAGGGGA
TCCAGGAACAATGGCAGCTTTCTTGCCATCAAAGCTGCTGATGGCACATATATTCTTAAT
GGTGACTACACTTTGTCCACCTTAGAGCAAGACATTATGTACAAAGGTGTTGTCTTGAGG
TACAGCGGCTCCTCTGCGGCATTGGAAAGAATTCGCAGCTTTAGCCCTCTCAAAGAGCCC
TTGACCATCCAGGTTCTTACTGTGGGCAATGCCCTTCGACCTAAAATTAAATACACCTAC
TTCGTAAAGAAGAAGAAGGAATCTTTCAATGCTATCCCCACTTTTTCAGCATGGGTCATT
GAAGAGTGGGGCGAATGTTCTAAGTCATGTGAATTGGGTTGGCAGAGAAGACTGGTAGAA
TGCCGAGACATTAATGGACAGCCTGCTTCCGAGTGTGCAAAGGAAGTGAAGCCAGCCAGC
ACCAGACCTTGTGCAGACCATCCCTGCCCCCAGTGGCAGCTGGGGGAGTGGTCATCATGT
TCTAAGACCTGTGGGAAGGGTTACAAAAAAAGAAGCTTGAAGTGTCTGTCCCATGATGGA
GGGGTGTTATCTCATGAGAGCTGTGATCCTTTAAAGAAACCTAAACATTTCATAGACTTT
TGCACAATGGCAGAATGCAGTTAA
Protein Properties
Number of Residues 967
Molecular Weight 105356.8
Theoretical pI 6.82
Pfam Domain Function
Signals
  • 1-49
Transmembrane Regions
  • None
Protein Sequence
>A disintegrin and metalloproteinase with thrombospondin motifs 1
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS
GenBank ID Protein 50845384
UniProtKB/Swiss-Prot ID Q9UHI8
UniProtKB/Swiss-Prot Entry Name ATS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006988.3
GeneCard ID ADAMTS1
GenAtlas ID ADAMTS1
HGNC ID HGNC:217
References
General References
  1. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  2. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  3. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  4. Vazquez F, Hastings G, Ortega MA, Lane TF, Oikemus S, Lombardo M, Iruela-Arispe ML: METH-1, a human ortholog of ADAMTS-1, and METH-2 are members of a new family of proteins with angio-inhibitory activity. J Biol Chem. 1999 Aug 13;274(33):23349-57. [PubMed:10438512 ]
  5. Glienke J, Schmitt AO, Pilarsky C, Hinzmann B, Weiss B, Rosenthal A, Thierauch KH: Differential gene expression by endothelial cells in distinct angiogenic states. Eur J Biochem. 2000 May;267(9):2820-30. [PubMed:10785405 ]