You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07276
Secondary Accession Numbers
  • 12895
Name Sedoheptulokinase
Synonyms
  1. Carbohydrate kinase-like protein
  2. SHK
Gene Name SHPK
Protein Type Enzyme
Biological Properties
General Function Involved in phosphotransferase activity, alcohol group as acceptor
Specific Function Acts as a modulator of macrophage activation through control of glucose metabolism (By similarity).
Pathways
  • Inositol Metabolism
Reactions
Adenosine triphosphate + Sedoheptulose → ADP + D-Sedoheptulose 7-phosphate details
GO Classification
Biological Process
pentose-phosphate shunt, non-oxidative branch
regulation of inflammatory response
cellular response to lipopolysaccharide
cellular response to interleukin-13
cellular response to interleukin-4
regulation of macrophage activation
Cellular Component
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, alcohol group as acceptor
Molecular Function
ATP binding
sedoheptulokinase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Cytoplasm (Potential)
Gene Properties
Chromosome Location 17
Locus 17p13
SNPs SHPK
Gene Sequence
>1437 bp
ATGGCTGCGCGGCCGATCACCCTCGGCATTGACCTGGGCACCACATCTGTGAAGGCAGCT
CTGCTGAGGGCCGCGCCCGACGACCCATCCGGGTTCGCAGTGCTGGCGAGCTGTGCCCGT
GCTGCGCGGGCAGAGGCGGCGGTCGAGAGCGCGGTGGCCGGGCCCCAGGGGCGGGAGCAG
GATGTGAGTAGAATCCTCCAAGCCCTACACGAGTGCCTTGCTGCCCTTCCCCGACCCCAG
CTCCGGAGCGTCGTGGGCATCGGGGTGTCGGGCCAGATGCATGGAGTCGTGTTTTGGAAA
ACAGGCCAAGGCTGTGAATGGACAGAGGGAGGGATTACCCCGGTGTTCGAGCCCCGAGCT
GTTAGCCACCTGGTCACGTGGCAGGATGGCCGATGTAGCAGCGAATTCCTGGCCTCTCTG
CCCCAGCCGAAGTCTCATCTCAGTGTGGCCACGGGCTTCGGCTGTGCAACCATCTTCTGG
CTTTTGAAATATCGCCCAGAGTTCCTGAAGTCCTACGACGCAGCCGGTACCATCCACGAC
TATGTGGTTGCCATGCTGTGTGGCTTGCCAAGACCTCTGATGTCCGACCAGAATGCTGCC
AGCTGGGGCTATTTCAACACGCAGAGCCAAAGCTGGAACGTAGAGACACTGAGGAGCTCG
GGTTTTCCTGTCCACCTGCTCCCAGACATCGCCGAGCCTGGCAGTGTGGCGGGCAGAACT
TCCCACATGTGGTTTGAAATCCCAAAGGGGACGCAGGTGGGAGTGGCCTTGGGTGATTTA
CAGGCCTCTGTCTATTCCTGCATGGCCCAGAGGACAGATGCAGTTCTCAACATCAGCACC
TCGGTTCAGCTGGCAGCCTCCATGCCTTCAGGATTCCAGCCTGCACAGACTCCAGACCCT
ACGGCCCCAGTCGCCTACTTCCCATACTTCAACAGGACCTACCTGGGGGTGGCCGCGTCA
CTCAACGGGGGCAATGTGCTGGCCACGTTCGTCCACATGCTGGTTCAGTGGATGGCAGAT
CTAGGCCTGGAGGTTGAAGAATCCACTGTGTATTCACGCATGATTCAGGCAGCTGTGCAG
CAGAGAGATACCCACCTGACCATCACCCCGACAGTGCTGGGGGAGAGGCACCTGCCGGAC
CAGCTGGCCTCAGTGACCAGAATCTCCTCCTCCGACCTCTCCCTGGGGCACGTGACCCGG
GCTCTGTGCCGAGGCATTGTTCAGAACCTGCACTCCATGCTTCCGATTCAGCAGCTCCAG
GAGTGGGGCGTGGAGAGGGTGATGGGCAGTGGGAGTGCGCTGTCCAGGAATGACGTGCTG
AAGCAGGAGGTGCAGAGGGCTTTCCCTTTGCCCATGTCCTTTGGGCAGGATGTGGATGCA
GCTGTCGGGGCAGCTCTGGTCATGCTCCGGAGACACCTCAACCAGAAGGAATCTTAG
Protein Properties
Number of Residues 478
Molecular Weight 51504.425
Theoretical pI 6.836
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sedoheptulokinase
MAARPITLGIDLGTTSVKAALLRAAPDDPSGFAVLASCARAARAEAAVESAVAGPQGREQ
DVSRILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRA
VSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHD
YVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRT
SHMWFEIPKGTQVGVALGDLQASVYSCMAQRTDAVLNISTSVQLAASMPSGFQPAQTPDP
TAPVAYFPYFNRTYLGVAASLNGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAVQ
QRDTHLTITPTVLGERHLPDQLASVTRISSSDLSLGHVTRALCRGIVQNLHSMLPIQQLQ
DWGVERVMGSGSALSRNDVLKQEVQRAFPLPMSFGQDVDAAVGAALVMLRRHLNQKES
GenBank ID Protein 74315356
UniProtKB/Swiss-Prot ID Q9UHJ6
UniProtKB/Swiss-Prot Entry Name SHPK_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_013276.2
GeneCard ID SHPK
GenAtlas ID SHPK
HGNC ID HGNC:1492
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Touchman JW, Anikster Y, Dietrich NL, Maduro VV, McDowell G, Shotelersuk V, Bouffard GG, Beckstrom-Sternberg SM, Gahl WA, Green ED: The genomic region encompassing the nephropathic cystinosis gene (CTNS): complete sequencing of a 200-kb segment and discovery of a novel gene within the common cystinosis-causing deletion. Genome Res. 2000 Feb;10(2):165-73. [PubMed:10673275 ]
  7. Wamelink MM, Struys EA, Jansen EE, Levtchenko EN, Zijlstra FS, Engelke U, Blom HJ, Jakobs C, Wevers RA: Sedoheptulokinase deficiency due to a 57-kb deletion in cystinosis patients causes urinary accumulation of sedoheptulose: elucidation of the CARKL gene. Hum Mutat. 2008 Apr;29(4):532-6. doi: 10.1002/humu.20685. [PubMed:18186520 ]