You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07282
Secondary Accession Numbers
  • 12901
Name Sn1-specific diacylglycerol lipase alpha
Synonyms
  1. DGL-alpha
  2. Neural stem cell-derived dendrite regulator
Gene Name DAGLA
Protein Type Unknown
Biological Properties
General Function Involved in triglyceride lipase activity
Specific Function Catalyzes the hydrolysis of diacylglycerol (DAG) to 2- arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling at mature synapses
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
triglyceride lipase activity
carboxylesterase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12.2
SNPs DAGLA
Gene Sequence
>3129 bp
ATGCCCGGGATCGTGGTGTTCCGGCGGCGCTGGTCTGTGGGCAGTGATGACCTCGTCCTA
CCGGCCATCTTCCTCTTTCTCCTGCATACCACCTGGTTTGTGATCCTGTCCGTGGTGCTC
TTCGGCCTGGTCTATAACCCGCACGAGGCCTGCTCCCTGAACCTGGTGGACCACGGCCGC
GGCTACCTGGGCATCCTGCTGAGCTGCATGATCGCTGAGATGGCCATCATCTGGCTGAGC
ATGCGCGGGGGCATCCTCTACACGGAGCCCCGTGACTCCATGCAGTACGTGCTCTACGTG
CGCCTGGCCATCCTGGTGATCGAGTTCATCTACGCCATCGTGGGCATCGTCTGGCTCACT
CAGTACTACACCTCCTGCAACGACCTCACTGCCAAGAATGTCACCCTCGGAATGGTTGTC
TGCAACTGGGTAGTCATCCTCAGTGTGTGCATCACTGTCCTCTGCGTCTTCGACCCCACG
GGCCGCACCTTTGTCAAGCTGAGAGCCACCAAGAGGAGGCAGCGTAACCTGCGGACCTAC
AACCTGCGGCACCGCTTAGAGGAGGGTCAAGCCACCAGCTGGTCGCGCCGGCTCAAAGTG
TTCCTCTGCTGCACGCGGACGAAGGACTCCCAGTCAGATGCCTACTCAGAAATCGCCTAC
CTCTTTGCGGAGTTCTTCCGGGACCTTGACATTGTGCCATCCGACATCATTGCTGGCCTG
GTGCTGCTCCGGCAGCGGCAGCGGGCCAAGCGCAACGCCGTGCTGGACGAGGCAAACAAT
GACATCTTGGCCTTCCTGTCTGGGATGCCGGTGACCAGAAACACCAAGTACCTCGACCTC
AAGAATTCACAAGAGATGCTCCGCTACAAAGAGGTCTGCTACTACATGCTCTTTGCCCTG
GCTGCCTACGGGTGGCCCATGTACCTGATGCGGAAGCCCGCCTGCGGCCTCTGCCAACTG
GCTCGGTCCTGCTCGTGTTGCCTGTGTCCTGCGAGGCCGCGGTTCGCCCCTGGAGTCACC
ATCGAGGAAGACAACTGCTGTGGCTGTAATGCCATTGCCATCCGGCGCCACTTCCTGGAC
GAGAACATGACTGCGGTGGACATCGTCTATACCTCCTGCCATGATGCGGTCTATGAAACG
CCCTTCTACGTGGCGGTGGACCATGACAAGAAGAAAGTGGTGATCAGTATCCGGGGGACC
CTGTCCCCCAAGGATGCCCTGACTGACCTGACGGGTGATGCTGAGCGCCTCCCCGTGGAG
GGGCACCACGGCACCTGGCTGGGCCACAAGGGTATGGTCCTCTCAGCTGAGTACATCAAG
AAGAAACTGGAGCAGGAGATGGTCCTGTCCCAGGCCTTTGGGCGAGACCTGGGCCGCGGA
ACCAAACACTACGGCCTGATTGTGGTGGGCCACTCCCTGGGCGCGGGCACTGCTGCCATC
CTCTCCTTCCTTCTGCGCCCACAGTATCCGACCCTCAAGTGCTTTGCCTACTCCCCGCCA
GGGGGCCTGCTGAGTGAGGATGCGATGGAGTATTCCAAGGAGTTCGTGACTGCTGTGGTT
CTGGGCAAAGACCTCGTCCCCAGGATTGGCCTCTCTCAGCTGGAAGGCTTCCGCAGACAG
CTCCTGGATGTCCTGCAGCGAAGCACCAAGCCCAAATGGCGGATCATCGTGGGGGCCACC
AAATGCATCCCCAAGTCGGAGCTGCCTGAGGAGGTAGAGGTGACCACCCTGGCCAGCACG
CGGCTCTGGACCCACCCCAGCGACCTAACTATAGCCCTCTCAGCCAGCACTCCACTCTAC
CCGCCCGGCCGCATCATCCACGTGGTCCACAACCACCCTGCAGAGCAGTGCTGCTGCTGT
GAGCAGGAGGAGCCCACATACTTTGCCATCTGGGGCGACAACAAGGCCTTCAATGAGGTG
ATCATCTCGCCAGCCATGCTGCATGAGCACCTGCCCTATGTGGTCATGGAGGGGCTCAAC
AAGGTGCTGGAGAACTACAACAAGGGGAAGACCGCTCTGCTCTCTGCAGCCAAGGTCATG
GTGAGCCCTACCGAGGTGGACCTGACTCCTGAGCTCATCTTCCAGCAGCAGCCACTCCCC
ACGGGGCCGCCCATGCCCACTGGCCTTGCCCTGGAGCTGCCGACTGCAGACCACCGCAAC
AGCAGCGTCAGGAGCAAGTCCCAGTCTGAGATGAGCCTGGAGGGCTTCTCGGAGGGGCGG
CTGCTGTCGCCAGTGGTTGCGGCGGCGGCCCGCCAGGACCCGGTGGAGCTGCTGCTGCTG
TCTACCCAGGAGCGGCTGGCGGCGGAGCTGCAGGCCCGGCGGGCACCACTGGCCACCATG
GAGAGCCTCTCGGACACTGAGTCCCTGTACAGCTTCGACTCGCGCCGCTCCTCAGGCTTC
CGCAGCATCCGGGGCTCCCCCAGCCTCCACGCTGTGCTGGAGCGTGATGAAGGCCACCTC
TTCTACATTGACCCTGCCATCCCCGAGGAAAACCCATCCCTGAGCTCGCGCACTGAGCTG
CTGGCGGCCGACAGCCTGTCCAAGCACTCACAGGACACGCAGCCCCTGGAGGCGGCCCTG
GGCAGTGGCGGCGTCACTCCTGAGCGGCCCCCCAGTGCTGCGGCCAATGACGAGGAGGAA
GAGGTTGGCGGTGGGGGTGGCGGGCCGGCCTCCCGCGGGGAGCTGGCGCTGCACAATGGG
CGCCTGGGGGACTCGCCCAGTCCTCAGGTGCTGGAATTCGCCGAGTTCATCGACAGCCTC
TTCAACCTGGACAGCAAGAGCAGCTCCTTCCAAGACCTCTACTGCATGGTGGTGCCCGAG
AGCCCCACCAGTGACTACGCTGAGGGCCCCAAGTCCCCCAGCCAGCAAGAGATCCTGCTC
CGTGCCCAGTTCGAGCCCAACCTGGTGCCCAAGCCCCCACGGCTCTTTGCCGGCTCAGCC
GACCCCTCCTCGGGCATCTCACTCTCGCCCTCCTTCCCGCTCAGCTCCTCGGGTGAGCTC
ATGGACCTGACGCCCACGGGCCTCAGTAGCCAGGAATGCCTGGCGGCTGACAAGATCCGG
ACTTCTACCCCCACTGGCCACGGAGCCAGCCCCGCCAAGCAAGATGAGCTGGTCATCTCA
GCACGCTAG
Protein Properties
Number of Residues 1042
Molecular Weight 114950.7
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 23-43
  • 61-81
  • 102-122
  • 137-157
Protein Sequence
>Sn1-specific diacylglycerol lipase alpha
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRN
SSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAELQARRAPLATM
ESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
RAQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIR
TSTPTGHGASPAKQDELVISAR
GenBank ID Protein 27262632
UniProtKB/Swiss-Prot ID Q9Y4D2
UniProtKB/Swiss-Prot Entry Name DGLA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006133.1
GeneCard ID DAGLA
GenAtlas ID DAGLA
HGNC ID HGNC:1165
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  3. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  4. Bisogno T, Howell F, Williams G, Minassi A, Cascio MG, Ligresti A, Matias I, Schiano-Moriello A, Paul P, Williams EJ, Gangadharan U, Hobbs C, Di Marzo V, Doherty P: Cloning of the first sn1-DAG lipases points to the spatial and temporal regulation of endocannabinoid signaling in the brain. J Cell Biol. 2003 Nov 10;163(3):463-8. [PubMed:14610053 ]
  5. Jung KM, Mangieri R, Stapleton C, Kim J, Fegley D, Wallace M, Mackie K, Piomelli D: Stimulation of endocannabinoid formation in brain slice cultures through activation of group I metabotropic glutamate receptors. Mol Pharmacol. 2005 Nov;68(5):1196-202. Epub 2005 Jul 28. [PubMed:16051747 ]