You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07283
Secondary Accession Numbers
  • 12902
Name Sn1-specific diacylglycerol lipase beta
Synonyms
  1. DGL-beta
  2. KCCR13L
Gene Name DAGLB
Protein Type Unknown
Biological Properties
General Function Involved in triglyceride lipase activity
Specific Function Catalyzes the hydrolysis of diacylglycerol (DAG) to 2- arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling at mature synapses
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
triglyceride lipase activity
carboxylesterase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22.1
SNPs DAGLB
Gene Sequence
>2019 bp
ATGCCGGGGATGGTACTCTTCGGCCGGCGCTGGGCCATCGCCAGCGACGACTTGGTCTTC
CCAGGGTTCTTCGAGCTGGTCGTGCGAGTGCTGTGGTGGATTGGCATTCTGACGTTGTAT
CTCATGCACAGAGGAAAGCTGGACTGTGCTGGTGGAGCCTTGCTCAGCAGTTACTTGATC
GTCCTCATGATTCTCCTGGCAGTTGTCATATGTACTGTGTCAGCCATCATGTGTGTCAGC
ATGAGAGGAACGATTTGTAACCCTGGACCGCGGAAGTCTATGTCTAAGCTGCTTTACATC
CGCCTGGCGCTGTTTTTTCCAGAGATGGTCTGGGCCTCTCTGGGGGCTGCCTGGGTGGCA
GATGGTGTTCAGTGCGACAGGACAGTTGTAAACGGCATCATCGCAACCGTCGTGGTCAGT
TGGATCATCATCGCTGCCACAGTGGTTTCCATTATCATTGTCTTTGACCCTCTTGGGGGG
AAAATGGCTCCATATTCCTCTGCCGGCCCCAGCCACCTGGATAGTCATGATTCAAGCCAG
TTACTTAATGGCCTCAAGACAGCAGCTACAAGCGTGTGGGAAACCAGAATCAAGCTCTTG
TGCTGTTGCATTGGGAAAGACGACCATACTCGGGTTGCTTTTTCGAGTACGGCAGAGCTT
TTCTCAACCTACTTTTCAGACACAGATCTGGTGCCCAGCGACATTGCGGCGGGCCTCGCC
CTGCTTCATCAGCAACAGGACAATATCAGGAACAACCAAGAGCCTGCCCAGGTGGTCTGC
CATGCCCCAGGGAGCTCCCAGGAAGCTGATCTGGATGCAGAATTAGAAAACTGCCATCAT
TACATGCAGTTTGCAGCAGCGGCCTATGGGTGGCCCCTCTACATCTACAGAAACCCCCTC
ACGGGGCTGTGCAGGATTGGTGGTGACTGCTGCAGAAGCAGAACCACAGACTATGACTTG
GTCGGAGGCGATCAGCTCAACTGTCACTTCGGCTCCATCCTGCACACCACAGGGCTGCAG
TACAGGGACTTCATCCACGTCAGCTTCCATGACAAGGTTTACGAGCTGCCGTTTTTAGTG
GCTCTGGATCACAGGAAAGAGTCTGTTGTGGTCGCTGTGAGGGGGACCATGTCTCTGCAG
GATGTCCTTACGGACCTGTCAGCGGAGAGTGAGGTGCTGGACGTGGAGTGTGAGGTGCAG
GACCGCCTGGCACACAAGGGTATTTCTCAAGCTGCCAGATACGTTTACCAACGACTCATC
AACGACGGGATTTTGAGCCAAGCCTTCAGCATTGCTCCTGAGTACCGGCTGGTCATAGTG
GGCCACAGCCTCGGGGGCGGGGCGGCCGCCCTGCTGGCCACCATGCTCAGAGCCGCCTAC
CCGCAGGTCAGGTGCTACGCCTTCTCCCCACCCCGGGGGCTGTGGAGCAAAGCTCTGCAG
GAATATTCTCAGAGCTTCATCGTGTCACTCGTCCTGGGGAAGGATGTGATTCCCAGGCTC
AGTGTGACCAACTTGGAAGATCTGAAGAGAAGAATCTTGCGAGTGGTCGCGCACTGCAAT
AAACCCAAGTACAAGATCTTGCTGCACGGTTTGTGGTACGAACTGTTTGGAGGAAACCCC
AACAACTTGCCCACGGAGCTGGACGGGGGCGACCAGGAAGTCCTGACACAGCCTCTTCTG
GGGGAGCAGAGCCTACTGACGCGCTGGTCCCCGGCCTACAGCTTCTCCAGCGACTCTCCA
CTGGACTCTTCTCCCAAGTACCCCCCTCTCTACCCTCCCGGCAGGATCATCCACCTGCAG
GAGGAGGGCGCCTCGGGGCGGTTTGGCTGCTGCTCTGCTGCTCACTATAGCGCCAAGTGG
TCACACGAAGCGGAATTCAGCAAAATACTCATAGGTCCGAAGATGCTCACCGACCACATG
CCAGACATCCTGATGCGGGCCTTGGACAGCGTGGTCTCCGACAGAGCGGCCTGCGTCTCC
TGTCCAGCACAAGGGGTCTCCAGTGTGGACGTGGCCTGA
Protein Properties
Number of Residues 672
Molecular Weight 73731.3
Theoretical pI 6.54
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 18-38
  • 59-79
  • 103-123
  • 133-153
Protein Sequence
>Sn1-specific diacylglycerol lipase beta
MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLI
VLMILLAVVICTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVA
DGVQCDRTVVNGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQ
LLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLA
LLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHHYMQFAAAAYGWPLYIYRNPL
TGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLV
ALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQ
EYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNP
NNLPTELDGGDQEVLTQPLLGEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQ
EEGASGRFGCCSAAHYSAKWSHEAEFSKILIGPKMLTDHMPDILMRALDSVVSDRAACVS
CPAQGVSSVDVA
GenBank ID Protein 17864023
UniProtKB/Swiss-Prot ID Q8NCG7
UniProtKB/Swiss-Prot Entry Name DGLB_HUMAN
PDB IDs Not Available
GenBank Gene ID AF450090
GeneCard ID DAGLB
GenAtlas ID DAGLB
HGNC ID HGNC:28923
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  7. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  8. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  9. Bisogno T, Howell F, Williams G, Minassi A, Cascio MG, Ligresti A, Matias I, Schiano-Moriello A, Paul P, Williams EJ, Gangadharan U, Hobbs C, Di Marzo V, Doherty P: Cloning of the first sn1-DAG lipases points to the spatial and temporal regulation of endocannabinoid signaling in the brain. J Cell Biol. 2003 Nov 10;163(3):463-8. [PubMed:14610053 ]