You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07291
Secondary Accession Numbers
  • 12911
Name Phospholipase D3
Synonyms
  1. Choline phosphatase 3
  2. HindIII K4L homolog
  3. Hu-K4
  4. PLD 3
  5. Phosphatidylcholine-hydrolyzing phospholipase D3
Gene Name PLD3
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways
  • Ether lipid metabolism
  • Glycerophospholipid metabolism
Reactions
A phosphatidylcholine + Water → Choline + a phosphatidate details
Phosphatidylcholine + Water → Phosphatidate + Choline details
Phosphatidylethanolamine + Water → Ethanolamine + Phosphatidate details
O-1-Alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + Water → 2-Acyl-1-(1-alkenyl)-sn-glycero-3-phosphate + Ethanolamine details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylglycerol biosynthetic process
lipid catabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
catalytic activity
Molecular Function
NAPE-specific phospholipase D activity
phospholipase D activity
Process
metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 19
Locus 19q13.2
SNPs PLD3
Gene Sequence
>1473 bp
ATGAAGCCTAAACTGATGTACCAGGAGCTGAAGGTGCCTGCAGAGGAGCCCGCCAATGAG
CTGCCCATGAATGAGATTGAGGCGTGGAAGGCTGCGGAAAAGAAAGCCCGCTGGGTCCTG
CTGGTCCTCATTCTGGCGGTTGTGGGCTTCGGAGCCCTGATGACTCAGCTGTTTCTATGG
GAATACGGCGACTTGCATCTCTTTGGGCCCAACCAGCGCCCAGCCCCCTGCTATGACCCT
TGCGAAGCAGTGCTGGTGGAAAGCATTCCTGAGGGCCTGGACTTCCCCAATGCCTCCACG
GGGAACCCTTCCACCAGCCAGGCCTGGCTGGGCCTGCTCGCCGGTGCGCACAGCAGCCTG
GACATCGCCTCCTTCTACTGGACCCTCACCAACAATGACACCCACACGCAGGAGCCCTCT
GCCCAGCAGGGTGAGGAGGTCCTCCGGCAGCTGCAGACCCTGGCACCAAAGGGCGTGAAC
GTCCGCATCGCTGTGAGCAAGCCCAGCGGGCCCCAGCCACAGGCGGACCTGCAGGCTCTG
CTGCAGAGCGGTGCCCAGGTCCGCATGGTGGACATGCAGAAGCTGACCCATGGCGTCCTG
CATACCAAGTTCTGGGTGGTGGACCAGACCCACTTCTACCTGGGCAGTGCCAACATGGAC
TGGCGTTCACTGACCCAGGTCAAGGAGCTGGGCGTGGTCATGTACAACTGCAGCTGCCTG
GCTCGAGACCTGACCAAGATCTTTGAGGCCTACTGGTTCCTGGGCCAGGCAGGCAGCTCC
ATCCCATCAACTTGGCCCCGGTTCTATGACACCCGCTACAACCAAGAGACACCAATGGAG
ATCTGCCTCAATGGAACCCCTGCTCTGGCCTACCTGGCGAGTGCGCCCCCACCCCTGTGT
CCAAGTGGCCGCACTCCAGACCTGAAGGCTCTACTCAACGTGGTGGACAATGCCCGGAGT
TTCATCTACGTCGCTGTCATGAACTACCTGCCCACTCTGGAGTTCTCCCACCCTCACAGG
TTCTGGCCTGCCATTGACGATGGGCTGCGGCGGGCCACCTACGAGCGTGGCGTCAAGGTG
CGCCTGCTCATCAGCTGCTGGGGACACTCGGAGCCATCCATGCGGGCCTTCCTGCTCTCT
CTGGCTGCCCTGCGTGACAACCATACCCACTCTGACATCCAGGTGAAACTCTTTGTGGTC
CCCGCGGATGAGGCCCAGGCTCGAATCCCATATGCCCGTGTCAACCACAACAAGTACATG
GTGACTGAACGCGCCACCTACATCGGAACCTCCAACTGGTCTGGCAACTACTTCACGGAG
ACGGCGGGCACCTCGCTGCTGGTGACGCAGAATGGGAGGGGCGGCCTGCGGAGCCAGCTG
GAGGCCATTTTCCTGAGGGACTGGGACTCCCCTTACAGCCATGACCTTGACACCTCAGCT
GACAGCGTGGGCAACGCCTGCCGCCTGCTCTGA
Protein Properties
Number of Residues 490
Molecular Weight 54704.865
Theoretical pI 6.472
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phospholipase D3
MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLW
EYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSL
DIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQAL
LQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCL
ARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLC
PSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKV
RLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSA
DSVGNACRLL
GenBank ID Protein 72534684
UniProtKB/Swiss-Prot ID Q8IV08
UniProtKB/Swiss-Prot Entry Name PLD3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001031696.2
GeneCard ID PLD3
GenAtlas ID PLD3
HGNC ID HGNC:17158
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cao JX, Koop BF, Upton C: A human homolog of the vaccinia virus HindIII K4L gene is a member of the phospholipase D superfamily. Virus Res. 1997 Apr;48(1):11-8. [PubMed:9140189 ]
  4. Munck A, Bohm C, Seibel NM, Hashemol Hosseini Z, Hampe W: Hu-K4 is a ubiquitously expressed type 2 transmembrane protein associated with the endoplasmic reticulum. FEBS J. 2005 Apr;272(7):1718-26. [PubMed:15794758 ]