You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07307
Secondary Accession Numbers
  • 12929
Name Phospholipase A1 member A
Synonyms
  1. PS-PLA1
  2. Phosphatidylserine-specific phospholipase A1
Gene Name PLA1A
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Hydrolyzes the ester bond at the sn-1 position of glycerophospholipids and produces 2-acyl lysophospholipids. Hydrolyzes phosphatidylserine (PS) in the form of liposomes and 1- acyl-2 lysophosphatidylserine (lyso-PS), but not triolein, phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidic acid (PA) or phosphatidylinositol (PI). Isoform 2 hydrolyzes lyso-PS but not PS. Hydrolysis of lyso-PS in peritoneal mast cells activated by receptors for IgE leads to stimulate histamine production
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Secreted (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3q13.13-q13.2
SNPs PLA1A
Gene Sequence
>1371 bp
ATGCCCCCAGGTCCCTGGGAGAGCTGCTTCTGGGTGGGGGGCCTCATTTTGTGGCTCAGC
GTTGGAAGTTCAGGGGATGCACCTCCTACCCCACAGCCAAAGTGCGCTGACTTCCAGAGC
GCCAACCTTTTTGAAGGCACCGATCTCAAAGTCCAGTTTCTCCTCTTTGTCCCTTCGAAT
CCTAGCTGTGGGCAGCTAGTAGAAGGAAGCAGTGACCTCCAAAACTCTGGGTTCAATGCC
ACTCTGGGAACCAAACTAATTATCCATGGATTCAGGGTTTTAGGAACAAAGCCTTCCTGG
ATTGACACATTTATTAGAACCCTTCTGCGTGCAACGAATGCTAATGTGATTGCCGTGGAC
TGGATTTATGGGTCTACAGGAGTCTACTTCTCAGCTGTGAAAAATGTGATTAAGTTGAGC
CTCGAGATCTCCCTTTTCCTCAATAAACTCCTGGTGCTGGGTGTGTCGGAATCCTCAATC
CACATCATTGGTGTTAGCCTGGGGGCCCACGTTGGGGGCATGGTGGGACAGCTCTTCGGA
GGCCAGCTGGGACAGATCACAGGCCTGGACCCCGCTGGACCTGAGTACACCAGGGCCAGT
GTGGAAGAGCGCTTGGATGCTGGAGATGCCCTCTTCGTGGAAGCCATCCACACAGACACC
GACAATTTGGGTATTCGGATTCCCGTTGGACATGTGGACTACTTCGTCAACGGAGGCCAA
GACCAACCTGGCTGCCCCACCTTCTTTTACGCAGGTTATAGTTATCTGATCTGTGATCAC
ATGAGGGCTGTGCACCTCTACATCAGCGCCCTGGAGAATTCCTGTCCACTGATGGCCTTT
CCCTGTGCCAGCTACAAGGCCTTCCTTGCTGGACGCTGTCTGGATTGCTTTAACCCTTTT
CTGCTTTCCTGCCCAAGGATAGGACTGGTGGAACAAGGTGGTGTCAAGATAGAGCCGCTC
CCCAAGGAAGTGAAAGTCTACCTCCTGACTACTTCCAGTGCTCCGTACTGCATGCATCAC
AGCCTCGTGGAGTTTCACTTGAAGGAACTGAGAAACAAGGACACCAACATCGAGGTTACC
TTCCTTAGCAGTAACATCACCTCTTCATCTAAGATCACCATACCTAAGCAGCAACGCTAT
GGGAAAGGAATCATAGCCCATGCCACCCCACAATGCCAGATAAACCAAGTGAAATTCAAG
TTTCAGTCTTCCAACCGAGTTTGGAAAAAAGACCGGACTACCATTATTGGGAAGTTCTGC
ACTGCCCTTTTGCCTGTCAATGACAGAGAAAAGATGGTCTGCTTACCTGAACCAGTGAAC
TTACAAGCAAGTGTGACTGTTTCCTGTGACCTGAAGATAGCCTGTGTGTAG
Protein Properties
Number of Residues 456
Molecular Weight 49715.0
Theoretical pI 7.4
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • None
Protein Sequence
>Phospholipase A1 member A
MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSN
PSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVD
WIYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFG
GQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQ
DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVT
FLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC
TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV
GenBank ID Protein 4090960
UniProtKB/Swiss-Prot ID Q53H76
UniProtKB/Swiss-Prot Entry Name PLA1A_HUMAN
PDB IDs Not Available
GenBank Gene ID AF035268
GeneCard ID PLA1A
GenAtlas ID PLA1A
HGNC ID HGNC:17661
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. van Groningen JJ, Egmond MR, Bloemers HP, Swart GW: nmd, a novel gene differentially expressed in human melanoma cell lines, encodes a new atypical member of the enzyme family of lipases. FEBS Lett. 1997 Mar 3;404(1):82-6. [PubMed:9074642 ]
  4. Nagai Y, Aoki J, Sato T, Amano K, Matsuda Y, Arai H, Inoue K: An alternative splicing form of phosphatidylserine-specific phospholipase A1 that exhibits lysophosphatidylserine-specific lysophospholipase activity in humans. J Biol Chem. 1999 Apr 16;274(16):11053-9. [PubMed:10196188 ]
  5. Wang J, Wen XY, Stewart AK, Hegele RA: Polymorphisms in the gene encoding phosphatidylserine-specific phospholipase A1 ( PSPLA1). J Hum Genet. 2002;47(11):611-3. [PubMed:12436198 ]