You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07310
Secondary Accession Numbers
  • 12932
Name Lysophosphatidic acid receptor 3
Synonyms
  1. LPA receptor 3
  2. LPA-3
  3. Lysophosphatidic acid receptor Edg-7
Gene Name LPAR3
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. May play a role in the development of ovarian cancer. Seems to be coupled to the G(i)/G(o) and G(q) families of heteromeric G proteins
Pathways
  • Lysophosphatidic Acid LPA3 Signalling
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
bioactive lipid receptor activity
lysosphingolipid and lysophosphatidic acid receptor activity
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.3
SNPs LPAR3
Gene Sequence
>1062 bp
ATGAATGAGTGTCACTATGACAAGCACATGGACTTTTTTTATAATAGGAGCAACACTGAT
ACTGTCGATGACTGGACAGGAACAAAGCTTGTGATTGTTTTGTGTGTTGGGACGTTTTTC
TGCCTGTTTATTTTTTTTTCTAATTCTCTGGTCATCGCGGCAGTGATCAAAAACAGAAAA
TTTCATTTCCCCTTCTACTACCTGTTGGCTAATTTAGCTGCTGCCGATTTCTTCGCTGGA
ATTGCCTATGTATTCCTGATGTTTAACACAGGCCCAGTTTCAAAAACTTTGACTGTCAAC
CGCTGGTTTCTCCGTCAGGGGCTTCTGGACAGTAGCTTGACTGCTTCCCTCACCAACTTG
CTGGTTATCGCCGTGGAGAGGCACATGTCAATCATGAGGATGCGGGTCCATAGCAACCTG
ACCAAAAAGAGGGTGACACTGCTCATTTTGCTTGTCTGGGCCATCGCCATTTTTATGGGG
GCGGTCCCCACACTGGGCTGGAATTGCCTCTGCAACATCTCTGCCTGCTCTTCCCTGGCC
CCCATTTACAGCAGGAGTTACCTTGTTTTCTGGACAGTGTCCAACCTCATGGCCTTCCTC
ATCATGGTTGTGGTGTACCTGCGGATCTACGTGTACGTCAAGAGGAAAACCAACGTCTTG
TCTCCGCATACAAGTGGGTCCATCAGCCGCCGGAGGACACCCATGAAGCTAATGAAGACG
GTGATGACTGTCTTAGGGGCGTTTGTGGTATGCTGGACCCCGGGCCTGGTGGTTCTGCTC
CTCGACGGCCTGAACTGCAGGCAGTGTGGCGTGCAGCATGTGAAAAGGTGGTTCCTGCTG
CTGGCGCTGCTCAACTCCGTCGTGAACCCCATCATCTACTCCTACAAGGACGAGGACATG
TATGGCACCATGAAGAAGATGATCTGCTGCTTCTCTCAGGAGAACCCAGAGAGGCGTCCC
TCTCGCATCCCCTCCACAGTCCTCAGCAGGAGTGACACAGGCAGCCAGTACATAGAGGAT
AGTATTAGCCAAGGTGCAGTCTGCAATAAAAGCACTTCCTAA
Protein Properties
Number of Residues 353
Molecular Weight 40128.1
Theoretical pI 9.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 32-52
  • 68-88
  • 102-124
  • 147-167
  • 187-207
  • 241-261
  • 277-297
Protein Sequence
>Lysophosphatidic acid receptor 3
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
GenBank ID Protein 5922725
UniProtKB/Swiss-Prot ID Q9UBY5
UniProtKB/Swiss-Prot Entry Name LPAR3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF127138
GeneCard ID LPAR3
GenAtlas ID LPAR3
HGNC ID HGNC:14298
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Contos JJ, Ishii I, Chun J: Lysophosphatidic acid receptors. Mol Pharmacol. 2000 Dec;58(6):1188-96. [PubMed:11093753 ]
  3. Bandoh K, Aoki J, Hosono H, Kobayashi S, Kobayashi T, Murakami-Murofushi K, Tsujimoto M, Arai H, Inoue K: Molecular cloning and characterization of a novel human G-protein-coupled receptor, EDG7, for lysophosphatidic acid. J Biol Chem. 1999 Sep 24;274(39):27776-85. [PubMed:10488122 ]
  4. Im DS, Heise CE, Harding MA, George SR, O'Dowd BF, Theodorescu D, Lynch KR: Molecular cloning and characterization of a lysophosphatidic acid receptor, Edg-7, expressed in prostate. Mol Pharmacol. 2000 Apr;57(4):753-9. [PubMed:10727522 ]