You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07336
Secondary Accession Numbers
  • 12958
Name Membrane-associated phosphatidylinositol transfer protein 1
Synonyms
  1. Drosophila retinal degeneration B homolog
  2. NIR-2
  3. PITPnm 1
  4. Phosphatidylinositol transfer protein, membrane-associated 1
  5. Pyk2 N-terminal domain-interacting receptor 2
Gene Name PITPNM1
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes. Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Endoplasmic reticulum membrane
  5. Golgi apparatus
  6. Golgi stack membrane
  7. Cleavage furrow
  8. Midbody
  9. Lipid droplet
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13
SNPs PITPNM1
Gene Sequence
>3735 bp
ATGCTCATCAAGGAATACCACATTCTGCTGCCCATGAGCCTGGACGAGTACCAGGTGGCC
CAGCTCTACATGATCCAGAAAAAGAGCCGGGAGGAGTCTAGTGGTGAGGGCAGCGGCGTG
GAGATCCTGGCCAACCGGCCCTACACGGATGGGCCCGGGGGCAGCGGGCAATACACACAC
AAGGTGTACCACGTGGGCTCCCACATCCCAGGCTGGTTCCGGGCACTGCTGCCCAAGGCT
GCCCTGCAGGTAGAAGAGGAATCCTGGAATGCCTACCCCTACACCCGAACCCGGTACACC
TGCCCTTTCGTGGAGAAATTCTCCATTGAAATTGAGACCTATTACCTGCCTGATGGGGGG
CAGCAGCCAAACGTCTTCAACCTGAGCGGGGCCGAGAGGAGACAGCGCATCCTGGACACC
ATCGACATCGTGCGGGATGCAGTGGCCCCAGGCGAGTACAAAGCAGAAGAGGACCCCCGG
CTTTATCACTCGGTCAAGACGGGCCGAGGGCCACTGTCTGATGACTGGGCACGGACGGCG
GCACAGACGGGGCCCCTTATGTGTGCCTATAAGCTGTGCAAGGTTGAGTTCCGCTACTGG
GGCATGCAAGCCAAGATCGAGCAGTTCATCCATGATGTAGGTCTGCGTCGGGTGATGCTG
CGGGCCCACCGCCAGGCCTGGTGCTGGCAGGATGAGTGGACAGAGCTGAGCATGGCTGAC
ATCCGGGCACTGGAAGAGGAGACTGCTCGCATGCTGGCCCAGCGCATGGCCAAGTGCAAC
ACAGGCAGTGAGGGGTCCGAGGCCCAGCCCCCCGGGAAACCGAGCACCGAGGCCCGGTCT
GCGGCCAGCAACACTGGCACCCCCGATGGGCCTGAGGCCCCCCCAGGCCCAGATGCCTCC
CCCGATGCCAGCTTTGGGAAGCAGTGGTCCTCATCCTCCCGTTCCTCCTACTCATCCCAA
CATGGAGGGGCTGTGTCTCCCCAGAGCTTGTCTGAGTGGCGCATGCAGAACATTGCCCGA
GACTCTGAGAACAGCTCCGAGGAAGAGTTCTTTGATGCCCACGAAGGCTTCTCGGACAGT
GAGGAGGTCTTCCCCAAGGAGATGACCAAGTGGAACTCCAATGACTTCATTGATGCCTTT
GCCTCCCCAGTGGAGGCAGAGGGAACGCCAGAGCCTGGAGCCGAGGCAGCTAAAGGCATT
GAGGATGGGGCCCAAGCACCCAGGGACTCAGAGGGCCTGGATGGAGCCGGGGAGCTGGGG
GCTGAGGCATGCGCAGTCCACGCCCTCTTCCTTATCCTGCACAGCGGCAACATCCTGGAC
TCAGGCCCTGGAGACGCCAACTCCAAGCAGGCGGATGTGCAGACGCTGAGCTCCGCCTTC
GAGGCCGTCACCCGCATCCACTTCCCTGAGGCCTTGGGCCACGTGGCGCTGCGACTGGTG
CCCTGTCCACCCATCTGCGCCGCCGCCTATGCCCTTGTCTCCAACCTGAGCCCTTACAGC
CACGATGGGGACAGCCTGTCTCGCTCCCAAGACCACATTCCACTGGCTGCCCTGCCACTG
CTGGCCACCTCATCCTCCCGCTACCAGGGCGCCGTGGCCACCGTCATTGCCCGCACCAAC
CAGGCCTACTCAGCCTTCCTGCGCTCACCTGAGGGTGCCGGCTTCTGTGGGCAGGTCGCA
CTGATTGGAGATGGTGTTGGTGGCATCCTGGGCTTTGATGCACTCTGCCACAGTGCTAAC
GCGGGCACCGGGAGTCGGGGCAGCAGCCGCCGTGGGAGCATGAACAATGAGCTGCTCTCT
CCGGAGTTTGGCCCAGTGCGGGACCCCCTGGCAGATGGTGTGGAAGGCCTGGGTCGGGGC
AGCCCAGAACCCTCGGCCTTGCCTCCCCAGCGCATCCCCAGCGACATGGCCAGTCCTGAG
CCCGAGGGCTCTCAGAACAGCCTTCAGGCAGCCCCCGCAACCACCTCCTCCTGGGAGCCC
CGGCGGGCAAGCACGGCCTTCTGCCCACCCGCTGCCAGTTCCGAGGCACCTGACGGCCCC
AGCAGCACTGCCCGCCTTGACTTCAAGGTCTCTGGCTTCTTCCTCTTCGGCTCCCCACTG
GGCCTGGTGCTGGCTCTGCGCAAAACTGTGATGCCCGCCCTGGAGGCAGCCCAGATGCGC
CCAGCCTGTGAACAGATCTACAACCTCTTCCACGCGGCCGACCCCTGCGCCTCACGCCTC
GAGCCCCTGCTGGCCCCGAAGTTCCAGGCCATCGCCCCACTGACCGTGCCCCGCTACCAG
AAGTTCCCCCTGGGAGATGGCTCATCCCTGCTGCTGGCCGACACTCTGCAGACGCACTCC
AGCCTCTTTCTGGAGGAGCTGGAGATGCTGGTGCCCTCAACACCCACCTCTACTAGCGGT
GCCTTCTGGAAGGGCAGTGAGTTGGCCACTGACCCCCCGGCCCAGCCAGCCGCCCCCAGC
ACCACCAGTGAGGTGGTTAAGATCCTGGAGCGCTGGTGGGGGACCAAGCGGATCGACTAC
TCGCTGTACTGCCCCGAGGCGCTCACCGCCTTTCCCACCGTCACGCTGCCCCACCTCTTC
CACGCCAGCTACTGGGAGTCCGCCGACGTGGTGGCGTTCATCCTGCGCCAGGTGATCGAG
AAGGAGCGGCCACAGCTGGCGGAATGCGAGGAGCCGTCCATCTACAGCCCGGCCTTCCCC
AGGGAGAAGTGGCAGCGAAAACGCACGCAGGTCAAGATCCGGAACGTCACTTCCAACCAC
CGGGCGAGCGACACGGTGGTGTGCGAGGGGCCGCCCCAGGTGCTAAGCGGGCGCTTCATG
TACGGGCCCCTGGACGTCGTCACGCTCACTGGAGAGAAGGTGGATGTCTACATCATGACG
CAGCCGCTGTCGGGCAAGTGGATCCACTTTGGCACCGAAGTCACCAATAGCTCGGGCCGC
CTCACCTTCCCAGTTCCCCCAGAACGCGCGCTGGGCATTGGTGTCTACCCCGTGCGCATG
GTGGTCAGGGGCGACCACACCTATGCCGAATGCTGCCTGACTGTGGTGGCCCGCGGCACG
GAGGCTGTGGTCTTCAGCATCGACGGCTCCTTCACCGCCAGCGTCTCCATCATGGGCAGC
GACCCCAAGGTGCGAGCTGGCGCCGTGGACGTGGTCAGGCACTGGCAGGACTCCGGCTAC
CTGATCGTGTATGTCACAGGCCGGCCGGATATGCAGAAGCACCGCGTGGTGGCATGGCTG
TCGCAGCACAACTTCCCCCACGGCGTCGTCTCCTTCTGCGACGGCCTCACCCACGACCCA
CTACGCCAGAAGGCAATGTTTCTGCAGAGCCTGGTGCAGGAGGTAGAACTGAACATCGTG
GCCGGTTATGGGTCTCCCAAAGATGTGGCTGTATACGCGGCGCTGGGGCTGTCCCCGAGC
CAGACCTACATCGTGGGCCGTGCCGTGCGGAAGCTACAGGCGCAGTGCCAGTTCCTGTCA
GACGGCTATGTGGCCCACCTGGGCCAGCTGGAAGCGGGCTCGCACTCGCATGCCTCCTCG
GGACCCCCGAGAGCTGCCTTGGGCAAGAGCAGCTATGGTGTGGCTGCCCCCGTGGACTTC
CTGCGCAAACAGAGCCAGCTGCTTCGCTCGAGGGGCCCCAGCCAGGCGGAGCGTGAGGGC
CCGGGAACACCACCCACCACCCTGGCACGGGGCAAAGCACGGAGCATCAGCCTGAAGCTG
GACAGCGAGGAGTGA
Protein Properties
Number of Residues 1244
Molecular Weight 134846.3
Theoretical pI 5.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Membrane-associated phosphatidylinositol transfer protein 1
MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTH
KVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGG
QQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTA
AQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMAD
IRALEEETARMLAQRMAKCNTGSEGSEAQPPGKPSTEARSAASNTGTPDGPEAPPGPDAS
PDASFGKQWSSSSRSSYSSQHGGAVSPQSLSEWRMQNIARDSENSSEEEFFDAHEGFSDS
EEVFPKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELG
AEACAVHALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLV
PCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAALPLLATSSSRYQGAVATVIARTN
QAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSANAGTGSRGSSRRGSMNNELLS
PEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAAPATTSSWEP
RRASTAFCPPAASSEAPDGPSSTARLDFKVSGFFLFGSPLGLVLALRKTVMPALEAAQMR
PACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHS
SLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDY
SLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEKERPQLAECEEPSIYSPAFP
REKWQRKRTQVKIRNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMT
QPLSGKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGT
EAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWL
SQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPS
QTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDF
LRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE
GenBank ID Protein 12667436
UniProtKB/Swiss-Prot ID O00562
UniProtKB/Swiss-Prot Entry Name PITM1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF334584
GeneCard ID PITPNM1
GenAtlas ID PITPNM1
HGNC ID HGNC:9003
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  5. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  6. Rubboli F, Bulfone A, Bogni S, Marchitiello A, Zollo M, Borsani G, Ballabio A, Banfi S: A mammalian homologue of the Drosophila retinal degeneration B gene: implications for the evolution of phototransduction mechanisms. Genes Funct. 1997 Jun;1(3):205-13. [PubMed:9680295 ]
  7. Lev S, Hernandez J, Martinez R, Chen A, Plowman G, Schlessinger J: Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein. Mol Cell Biol. 1999 Mar;19(3):2278-88. [PubMed:10022914 ]
  8. Ocaka L, Spalluto C, Wilson DI, Hunt DM, Halford S: Chromosomal localization, genomic organization and evolution of the genes encoding human phosphatidylinositol transfer protein membrane-associated (PITPNM) 1, 2 and 3. Cytogenet Genome Res. 2005;108(4):293-302. [PubMed:15627748 ]
  9. Litvak V, Shaul YD, Shulewitz M, Amarilio R, Carmon S, Lev S: Targeting of Nir2 to lipid droplets is regulated by a specific threonine residue within its PI-transfer domain. Curr Biol. 2002 Sep 3;12(17):1513-8. [PubMed:12225667 ]
  10. Tian D, Litvak V, Toledo-Rodriguez M, Carmon S, Lev S: Nir2, a novel regulator of cell morphogenesis. Mol Cell Biol. 2002 Apr;22(8):2650-62. [PubMed:11909959 ]
  11. Litvak V, Argov R, Dahan N, Ramachandran S, Amarilio R, Shainskaya A, Lev S: Mitotic phosphorylation of the peripheral Golgi protein Nir2 by Cdk1 provides a docking mechanism for Plk1 and affects cytokinesis completion. Mol Cell. 2004 May 7;14(3):319-30. [PubMed:15125835 ]
  12. Amarilio R, Ramachandran S, Sabanay H, Lev S: Differential regulation of endoplasmic reticulum structure through VAP-Nir protein interaction. J Biol Chem. 2005 Feb 18;280(7):5934-44. Epub 2004 Nov 15. [PubMed:15545272 ]
  13. Litvak V, Dahan N, Ramachandran S, Sabanay H, Lev S: Maintenance of the diacylglycerol level in the Golgi apparatus by the Nir2 protein is critical for Golgi secretory function. Nat Cell Biol. 2005 Mar;7(3):225-34. Epub 2005 Feb 20. [PubMed:15723057 ]