You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07342
Secondary Accession Numbers
  • 12964
Name 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
Synonyms
  1. PLC-zeta-1
  2. Phosphoinositide phospholipase C-zeta-1
  3. Phospholipase C-zeta-1
  4. Testis-development protein NYD-SP27
Gene Name PLCZ1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. In vitro, hydrolyzes PtdIns(4,5)P2 in a Ca(2+)-dependent manner. Triggers intracellular Ca(2+) oscillations in oocytes solely during M phase and is involved in inducing oocyte activation and initiating embryonic development up to the blastocyst stage. Is therefore a strong candidate for the egg-activating soluble sperm factor that is transferred from the sperm into the egg cytoplasm following gamete membrane fusion. May exert an inhibitory effect on phospholipase-C-coupled processes that depend on calcium ions and protein kinase C, including CFTR trafficking and function.
Pathways
  • Calcium signaling pathway
  • Inositol phosphate metabolism
  • Oocyte meiosis
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → Inositol 1,4,5-trisphosphate + DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) details
1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate + Water → Inositol 1,4,5-trisphosphate + 1,2-Diacyl-sn-glycerol details
GO Classification
Biological Process
multicellular organismal development
lipid catabolic process
egg activation
calcium ion transport
intracellular signal transduction
Cellular Component
perinuclear region of cytoplasm
nucleus
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
phospholipase c activity
phosphoinositide phospholipase c activity
calcium ion binding
lipase activity
phospholipase activity
Molecular Function
phosphatidylinositol phospholipase C activity
signal transducer activity
calcium ion binding
Process
metabolic process
primary metabolic process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. perinuclear region
Gene Properties
Chromosome Location 12
Locus 12p12.3
SNPs PLCZ1
Gene Sequence
>1827 bp
ATGGAAATGAGATGGTTTTTGTCAAAGATTCAGGATGACTTCAGAGGTGGAAAAATTAAC
CTAGAAAAAACTCAGAGGTTACTTGAAAAATTAGATATTCGGTGCAGTTATATTCATGTG
AAACAGATTTTTAAGGACAATGACAGGCTGAAACAAGGAAGAATCACCATAGAAGAATTT
AGAGCAATTTATCGAATTATCACGCACAGAGAAGAAATTATTGAGATTTTCAACACATAT
TCTGAAAACCGGAAAATTCTTTTAGCAAGTAATCTGGCTCAATTTCTGACACAAGAACAA
TATGCAGCTGAGATGAGTAAAGCTATTGCTTTTGAGATCATTCAGAAATACGAGCCTATC
GAAGAAGTTAGGAAAGCACACCAAATGTCATTAGAAGGTTTTACAAGATACATGGATTCA
CGTGAATGTCTACTGTTTAAAAATGAATGTAGAAAAGTTTATCAAGATATGACTCATCCA
TTAAATGATTATTTTATTTCATCTTCACATAACACATATTTGGTATCTGATCAATTATTG
GGACCAAGTGACCTTTGGGGATATGTAAGTGCCCTTGTGAAAGGATGCCGTTGTTTGGAG
ATTGACTGCTGGGATGGAGCACAAAATGAACCTGTTGTATATCATGGCTACACACTCACA
AGCAAACTTCTGTTTAAAACTGTTATCCAAGCTATACACAAGTATGCATTCATGACATCT
GACTACCCAGTGGTGCTCTCTTTAGAAAATCACTGCTCCACTGCCCAACAAGAAGTAATG
GCAGACAATTTGCAGGCTACTTTTGGAGAGTCCTTGCTTTCTGATATGCTTGATGATTTT
CCTGATACTCTACCATCACCAGAGGCACTAAAATTCAAAATATTAGTTAAAAATAAGAAA
ATAGGAACCTTAAAGGAAACCCATGAAAGAAAAGGTTCTGATAAGCGTGGAGACAATCAA
GACAAGGAAACAGGGGTAAAAAAGTTACCTGGAGTAATGCTTTTCAAGAAAAAGAAGACC
AGGAAGCTAAAAATTGCTCTGGCCTTATCTGATCTTGTCATTTATACGAAAGCTGAGAAA
TTCAAAAGCTTTCAACATTCAAGATTATATCAGCAATTTAATGAAAATAATTCTATTGGG
GAGACACAAGCCCGAAAACTTTCAAAATTGCGAGTCCATGAGTTTATTTTTCACACCAGG
AAGTTCATTACCAGAATATATCCCAAAGCAACAAGAGCAGACTCTTCTAATTTTAATCCC
CAAGAATTTTGGAATATAGGTTGTCAAATGGTGGCTTTAAATTTCCAGACCCCTGGTCTG
CCCATGGATCTGCAAAATGGGAAATTTTTGGATAATGGTGGTTCTGGATATATTTTGAAA
CCACATTTCTTAAGAGAGAGTAAATCATACTTTAACCCAAGTAACATAAAAGAGGGTATG
CCAATTACACTTACAATAAGGCTCATCAGTGGTATCCAGTTGCCTCTTACTCATTCATCA
TCTAACAAAGGTGATTCATTAGTAATTATAGAAGTTTTTGGTGTTCCAAATGATCAAATG
AAGCAGCAGACTCGTGTAATTAAAAAAAATGCTTTTAGTCCAAGATGGAATGAAACATTC
ACATTTATTATTCATGTCCCAGAATTGGCATTGATACGTTTTGTTGTTGAAGGTCAAGGT
TTAATAGCAGGAAATGAATTTCTTGGGCAATATACTTTGCCACTTCTATGCATGAACAAA
GGTTATCGTCGTATTCCTCTGTTTTCCAGAATGGGTGAGAGCCTTGAGCCTGCTTCACTG
TTTGTTTATGTTTGGTACGTCAGATAA
Protein Properties
Number of Residues 608
Molecular Weight 70410.725
Theoretical pI 9.034
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVEGQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR
GenBank ID Protein 25053795
UniProtKB/Swiss-Prot ID Q86YW0
UniProtKB/Swiss-Prot Entry Name PLCZ1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF532185
GeneCard ID PLCZ1
GenAtlas ID PLCZ1
HGNC ID HGNC:19218
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cox LJ, Larman MG, Saunders CM, Hashimoto K, Swann K, Lai FA: Sperm phospholipase Czeta from humans and cynomolgus monkeys triggers Ca2+ oscillations, activation and development of mouse oocytes. Reproduction. 2002 Nov;124(5):611-23. [PubMed:12416999 ]
  4. Zhu H, Zhu JX, Lo PS, Li J, Leung KM, Rowlands DK, Tsang LL, Yu MK, Jiang JL, Lam SY, Chung YW, Zhou Z, Sha J, Chang Chan H: Rescue of defective pancreatic secretion in cystic-fibrosis cells by suppression of a novel isoform of phospholipase C. Lancet. 2003 Dec 20;362(9401):2059-65. [PubMed:14697805 ]
  5. Rogers NT, Hobson E, Pickering S, Lai FA, Braude P, Swann K: Phospholipase Czeta causes Ca2+ oscillations and parthenogenetic activation of human oocytes. Reproduction. 2004 Dec;128(6):697-702. [PubMed:15579586 ]