You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07349
Secondary Accession Numbers
  • 12971
Name Glycine N-acyltransferase
Synonyms
  1. AAc
  2. Acyl-CoA:glycine N-acyltransferase
  3. Aralkyl acyl-CoA N-acyltransferase
  4. Aralkyl acyl-CoA:amino acid N-acyltransferase
  5. HRP-1(CLP)
  6. Benzoyl-coenzyme A:glycine N-acyltransferase
  7. Glycine N-benzoyltransferase
Gene Name GLYAT
Protein Type Enzyme
Biological Properties
General Function Involved in glycine N-acyltransferase activity
Specific Function Mitochondrial acyltransferase which transfers an acyl group to the N-terminus of glycine and glutamine, although much less efficiently. Can conjugate numerous substrates to form a variety of N-acylglycines, with a preference for benzoyl-CoA over phenylacetyl-CoA as acyl donors. Thereby detoxify xenobiotics, such as benzoic acid or salicylic acid, and endogenous organic acids, such as isovaleric acid.
Pathways
  • Phenylacetate Metabolism
  • Phenylalanine metabolism
Reactions
Acyl-CoA + Glycine → Coenzyme A + N-acylglycine details
Benzoyl-CoA + Glycine → Coenzyme A + Hippuric acid details
Phenylacetyl-CoA + Glycine → Phenylacetylglycine + Coenzyme A details
4-Hydroxybenzoic acid → 4-Hydroxyhippuric acid details
Benzoic acid → Hippuric acid details
Protocatechuic acid → 2-{[(3,4-dihydroxyphenyl)(hydroxy)methylidene]amino}acetic acid details
3-Hydroxybenzoic acid → 3-Hydroxyhippuric acid details
m-Trigallic acid → 2-[({3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxyphenyl}(hydroxy)methylidene)amino]acetic acid details
3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoic acid → 2-({[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)phenyl](hydroxy)methylidene}amino)acetic acid details
Gallic acid → 2-{[hydroxy(3,4,5-trihydroxyphenyl)methylidene]amino}acetic acid details
3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-2,4,5-trihydroxybenzoic acid → 2-[({3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-2,4,5-trihydroxyphenyl}(hydroxy)methylidene)amino]acetic acid details
3,4-dihydroxy-5-[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid → 2-[({3,4-dihydroxy-5-[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]phenyl}(hydroxy)methylidene)amino]acetic acid details
3-[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxybenzoic acid → 2-[({3-[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxyphenyl}(hydroxy)methylidene)amino]acetic acid details
2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoic acid → 2-({hydroxy[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)phenyl]methylidene}amino)acetic acid details
3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoic acid → 2-({[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)phenyl](hydroxy)methylidene}amino)acetic acid details
2,3,4-trihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoic acid → 2-({hydroxy[2,3,4-trihydroxy-5-(3,4,5-trihydroxybenzoyloxy)phenyl]methylidene}amino)acetic acid details
2,3,4,5-tetrahydroxybenzoic acid → 2-{[hydroxy(2,3,4,5-tetrahydroxyphenyl)methylidene]amino}acetic acid details
3,5-Dihydroxybenzoic acid → 2-{[(3,5-dihydroxyphenyl)(hydroxy)methylidene]amino}acetic acid details
1-oxo-1H-isochromene-3-carboxylic acid → 2-{[hydroxy(1-oxo-1H-isochromen-3-yl)methylidene]amino}acetic acid details
7-hydroxy-1-oxo-1H-isochromene-3-carboxylic acid → 2-[(7-hydroxy-1-oxo-1H-isochromen-3-yl)formamido]acetic acid details
6-hydroxy-1-oxo-1H-isochromene-3-carboxylic acid → 2-{[hydroxy(6-hydroxy-1-oxo-1H-isochromen-3-yl)methylidene]amino}acetic acid details
5-hydroxy-1-oxo-1H-isochromene-3-carboxylic acid → 2-[(5-hydroxy-1-oxo-1H-isochromen-3-yl)formamido]acetic acid details
6-hydroxy-7-methoxy-2H-1,3-benzodioxole-5-carboxylic acid → 2-{[hydroxy(6-hydroxy-7-methoxy-2H-1,3-benzodioxol-5-yl)methylidene]amino}acetic acid details
7-hydroxy-6-methoxy-2H-1,3-benzodioxole-5-carboxylic acid → 2-{[hydroxy(7-hydroxy-6-methoxy-2H-1,3-benzodioxol-5-yl)methylidene]amino}acetic acid details
4,4',5,5',6,6'-hexahydroxy-[1,1'-biphenyl]-2,2'-dicarboxylic acid → 6'-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2',3',4,4',5,6-hexahydroxy-[1,1'-biphenyl]-2-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 2-{[hydroxy({3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromen-1-yl})methylidene]amino}acetic acid details
3,4-Methylenedioxybenzoic acid → 2-{[(2H-1,3-benzodioxol-5-yl)(hydroxy)methylidene]amino}acetic acid details
6-hydroxy-2H-1,3-benzodioxole-5-carboxylic acid → 2-{[hydroxy(6-hydroxy-2H-1,3-benzodioxol-5-yl)methylidene]amino}acetic acid details
4-methoxy-1-benzofuran-5-carboxylic acid → 2-{[hydroxy(4-methoxy-1-benzofuran-5-yl)methylidene]amino}acetic acid details
7-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 2-[({7-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromen-1-yl}(hydroxy)methylidene)amino]acetic acid details
2-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 2-({2-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromen-1-yl}formamido)acetic acid details
3,4,8,9,10-pentahydroxy-6-oxo-7-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 2-{[hydroxy({3,4,8,9,10-pentahydroxy-6-oxo-7-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromen-1-yl})methylidene]amino}acetic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 2-({3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromen-1-yl}formamido)acetic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromene-1-carboxylic acid → 2-{[hydroxy({3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromen-1-yl})methylidene]amino}acetic acid details
2,4,6-Trihydroxybenzoic acid → 2-{[hydroxy(2,4,6-trihydroxyphenyl)methylidene]amino}acetic acid details
2,3,4,6-tetrahydroxybenzoic acid → 2-{[hydroxy(2,3,4,6-tetrahydroxyphenyl)methylidene]amino}acetic acid details
2,3,4-Trihydroxybenzoic acid → 2-{[hydroxy(2,3,4-trihydroxyphenyl)methylidene]amino}acetic acid details
2,4,5-trihydroxybenzoic acid → 2-{[hydroxy(2,4,5-trihydroxyphenyl)methylidene]amino}acetic acid details
p-Anisic acid → 2-[(4-methoxyphenyl)formamido]acetic acid details
2-hydroxy-4-methoxybenzoic acid → 2-{[hydroxy(2-hydroxy-4-methoxyphenyl)methylidene]amino}acetic acid details
Salicylic acid → Salicyluric acid details
2-(2H-1,3-benzodioxol-5-yl)-6-hydroxy-1-benzofuran-5-carboxylic acid → 2-{[2-(2H-1,3-benzodioxol-5-yl)-6-hydroxy-1-benzofuran-5-yl]formamido}acetic acid details
2-(6-hydroxy-2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-carboxylic acid → 2-({hydroxy[2-(6-hydroxy-2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]methylidene}amino)acetic acid details
2-(2H-1,3-benzodioxol-5-yl)-7-hydroxy-1-benzofuran-5-carboxylic acid → 2-({[2-(2H-1,3-benzodioxol-5-yl)-7-hydroxy-1-benzofuran-5-yl](hydroxy)methylidene}amino)acetic acid details
2-(2H-1,3-benzodioxol-5-yl)-4-hydroxy-1-benzofuran-5-carboxylic acid → 2-({[2-(2H-1,3-benzodioxol-5-yl)-4-hydroxy-1-benzofuran-5-yl](hydroxy)methylidene}amino)acetic acid details
Syringic acid → 2-{[hydroxy(4-hydroxy-3,5-dimethoxyphenyl)methylidene]amino}acetic acid details
3-O-Methylgallic acid → 2-{[(3,4-dihydroxy-5-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
3,5-dimethoxybenzoic acid → 2-{[(3,5-dimethoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
3-hydroxy-5-methoxybenzoic acid → 2-{[hydroxy(3-hydroxy-5-methoxyphenyl)methylidene]amino}acetic acid details
Vanillic acid → Vanilloylglycine details
3-Methoxybenzoic acid → 2-{[hydroxy(3-methoxyphenyl)methylidene]amino}acetic acid details
2-Pyrocatechuic acid → 2-{[(2,3-dihydroxyphenyl)(hydroxy)methylidene]amino}acetic acid details
Gentisic acid → Gentisuric acid details
2-[7,8,9,12,13,14,17,18,19,25-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]-3,4,5-trihydroxybenzoic acid → 2-[({2-[7,8,9,12,13,14,17,18,19,25-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]-3,4,5-trihydroxyphenyl}(hydroxy)methylidene)amino]acetic acid details
Indole-3-carboxylic acid → 2-{[hydroxy(1H-indol-3-yl)methylidene]amino}acetic acid details
5-hydroxy-1H-indole-3-carboxylic acid → 2-{[hydroxy(5-hydroxy-1H-indol-3-yl)methylidene]amino}acetic acid details
6-hydroxy-1H-indole-3-carboxylic acid → 2-{[hydroxy(6-hydroxy-1H-indol-3-yl)methylidene]amino}acetic acid details
7-hydroxy-1H-indole-3-carboxylic acid → 2-{[hydroxy(7-hydroxy-1H-indol-3-yl)methylidene]amino}acetic acid details
4-hydroxy-1H-indole-3-carboxylic acid → 2-{[hydroxy(4-hydroxy-1H-indol-3-yl)methylidene]amino}acetic acid details
Coumarin-4-carboxylic acid → 2-{[hydroxy(2-oxo-2H-chromen-4-yl)methylidene]amino}acetic acid details
6-hydroxy-2-oxo-2H-chromene-4-carboxylic acid → 2-{[hydroxy(6-hydroxy-2-oxo-2H-chromen-4-yl)methylidene]amino}acetic acid details
7-hydroxy-2-oxo-2H-chromene-4-carboxylic acid → 2-{[hydroxy(7-hydroxy-2-oxo-2H-chromen-4-yl)methylidene]amino}acetic acid details
8-hydroxy-2-oxo-2H-chromene-4-carboxylic acid → 2-{[hydroxy(8-hydroxy-2-oxo-2H-chromen-4-yl)methylidene]amino}acetic acid details
5-hydroxy-2-oxo-2H-chromene-4-carboxylic acid → 2-{[hydroxy(5-hydroxy-2-oxo-2H-chromen-4-yl)methylidene]amino}acetic acid details
Theaflavic acid → 2-({hydroxy[3,4,6-trihydroxy-5-oxo-1-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-5H-benzo[7]annulen-8-yl]methylidene}amino)acetic acid details
Epitheaflavic acid 3'-gallate → 2-[({1-[5,7-dihydroxy-3-(3,4,5-trihydroxybenzoyloxy)-3,4-dihydro-2H-1-benzopyran-2-yl]-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulen-8-yl}(hydroxy)methylidene)amino]acetic acid details
5-hydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[hydroxy(5-hydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)methylidene]amino}acetic acid details
4,5-dihydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}benzoic acid → 2-{[(4,5-dihydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}phenyl)(hydroxy)methylidene]amino}acetic acid details
2-{[3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 2-{[(2-{[3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2-{[3-(2,4-dihydroxy-3-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 2-{[(2-{[3-(2,4-dihydroxy-3-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2,3-dihydroxy-6-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[(2,3-dihydroxy-6-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2-{[3-(2,4-dihydroxy-5-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 2-{[(2-{[3-(2,4-dihydroxy-5-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2-{[3-(3,4-dihydroxy-5-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 2-{[(2-{[3-(3,4-dihydroxy-5-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
5-hydroxy-2-({hydroxy[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]methylidene}amino)-4-methoxybenzoic acid → 2-({hydroxy[5-hydroxy-2-({hydroxy[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]methylidene}amino)-4-methoxyphenyl]methylidene}amino)acetic acid details
5-hydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[hydroxy(5-hydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)methylidene]amino}acetic acid details
4,5-dihydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}benzoic acid → 2-{[(4,5-dihydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}phenyl)(hydroxy)methylidene]amino}acetic acid details
5-hydroxy-2-{[1-hydroxy-3-(3-hydroxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[hydroxy(5-hydroxy-2-{[1-hydroxy-3-(3-hydroxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)methylidene]amino}acetic acid details
2,3-dihydroxy-6-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[(2,3-dihydroxy-6-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
5-hydroxy-2-{[1-hydroxy-3-(3-hydroxy-5-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 2-{[hydroxy(5-hydroxy-2-{[1-hydroxy-3-(3-hydroxy-5-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxyphenyl)methylidene]amino}acetic acid details
5-hydroxy-2-({hydroxy[3-(3-methoxyphenyl)oxiran-2-yl]methylidene}amino)-4-methoxybenzoic acid → 2-({hydroxy[5-hydroxy-2-({hydroxy[3-(3-methoxyphenyl)oxiran-2-yl]methylidene}amino)-4-methoxyphenyl]methylidene}amino)acetic acid details
2,4-Dihydroxybenzoic acid → 2-{[(2,4-dihydroxyphenyl)(hydroxy)methylidene]amino}acetic acid details
7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
7,13,14-trihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({hydroxy[7,13,14-trihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methylidene}amino)acetic acid details
7,13,14-trihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({hydroxy[7,13,14-trihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methylidene}amino)acetic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
5-(3,3-dimethyloxirane-2-carbonyl)-7,14-dihydroxy-6-methoxy-4,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[5-(3,3-dimethyloxirane-2-carbonyl)-7,14-dihydroxy-6-methoxy-4,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
13-chloro-5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[13-chloro-5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-[({13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}(hydroxy)methylidene)amino]acetic acid details
13-chloro-6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-[({13-chloro-6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}(hydroxy)methylidene)amino]acetic acid details
5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
5,13,14-trihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({hydroxy[5,13,14-trihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methylidene}amino)acetic acid details
5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-[({6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}(hydroxy)methylidene)amino]acetic acid details
5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-[({5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}(hydroxy)methylidene)amino]acetic acid details
5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 2-({[5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl](hydroxy)methylidene}amino)acetic acid details
4-hydroxy-3-(3-methylbut-2-en-1-yl)benzoic acid → 2-{[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]formamido}acetic acid details
4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)benzoic acid → 2-{[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]formamido}acetic acid details
3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxybenzoic acid → 2-[({3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}(hydroxy)methylidene)amino]acetic acid details
3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)benzoic acid → 2-({[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl](hydroxy)methylidene}amino)acetic acid details
Isovanillic acid → 2-{[hydroxy(3-hydroxy-4-methoxyphenyl)methylidene]amino}acetic acid details
2,5-dihydroxy-4-methoxybenzoic acid → 2-{[(2,5-dihydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2,3-dihydroxy-4-methoxybenzoic acid → 2-{[(2,3-dihydroxy-4-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2,3,4-trimethoxybenzoic acid → 2-{[hydroxy(2,3,4-trimethoxyphenyl)methylidene]amino}acetic acid details
3-hydroxy-2,4-dimethoxybenzoic acid → 2-{[hydroxy(3-hydroxy-2,4-dimethoxyphenyl)methylidene]amino}acetic acid details
2-hydroxy-3,4-dimethoxybenzoic acid → 2-{[hydroxy(2-hydroxy-3,4-dimethoxyphenyl)methylidene]amino}acetic acid details
4-hydroxy-2,3-dimethoxybenzoic acid → 2-{[hydroxy(4-hydroxy-2,3-dimethoxyphenyl)methylidene]amino}acetic acid details
6-hydroxy-2,3,4-trimethoxybenzoic acid → 2-{[hydroxy(6-hydroxy-2,3,4-trimethoxyphenyl)methylidene]amino}acetic acid details
2-Methoxybenzoic acid → 2-{[hydroxy(2-methoxyphenyl)methylidene]amino}acetic acid details
2,4-dihydroxy-3-methoxybenzoic acid → 2-{[(2,4-dihydroxy-3-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
2,4-dihydroxy-5-methoxybenzoic acid → 2-{[(2,4-dihydroxy-5-methoxyphenyl)(hydroxy)methylidene]amino}acetic acid details
GO Classification
Biological Process
acyl-CoA metabolic process
glycine metabolic process
monocarboxylic acid metabolic process
xenobiotic metabolic process
response to toxin
Cellular Component
mitochondrial matrix
Component
mitochondrion
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
glycine n-acyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
n-acyltransferase activity
Molecular Function
glycine N-acyltransferase activity
glycine N-benzoyltransferase activity
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 11
Locus 11q12.1
SNPs GLYAT
Gene Sequence
>891 bp
ATGATGTTACCATTGCAAGGTGCCCAGATGCTGCAGATGCTGGAGAAATCCTTGAGGAAG
AGCCTCCCAGCATCCTTAAAGGTTTATGGAACTGTCTTTCACATAAACCATGGAAATCCA
TTCAATCTGAAGGCTGTGGTGGACAAGTGGCCTGATTTTAATACAGTGGTTGTCTGCCCT
CAGGAGCAGGATATGACAGATGACCTTGATCACTATACCAATACTTACCAAATCTACTCC
AAAGATCCCCAAAACTGTCAGGAATTCCTTGGATCACCAGAACTCATCAACTGGAAACAG
CATTTACAGATTCAAAGTTCACAGCCTAGCCTGAATGAGGCTATACAAAATCTTGCAGCC
ATTAAGTCCTTCAAAGTCAAACAAACACAACGCATTCTCTATATGGCAGCTGAAACAGCC
AAGGAACTGACTCCTTTCCTGCTGAAATCAAAGATTTTATCTCCCAATGGTGGCAAACCC
AAGGCCATCAACCAAGAGATGTTTAAACTCTCATCCATGGATGTTACCCATGCTCACTTG
GTGAATAAATTCTGGCATTTTGGTGGTAATGAGAGGAGCCAGAGATTCATTGAGCGCTGC
ATTCAGACCTTTCCCACCTGCTGTCTCCTGGGGCCTGAGGGGACCCCTGTGTGCTGGGAT
CTAATGGACCAGACTGGAGAGATGAGAATGGCAGGCACCTTGCCGGAATACCGGCTCCAT
GGCCTTGTGACGTATGTCATCTATTCCCACGCCCAGAAATTGGGCAAACTTGGGTTTCCT
GTCTATTCTCATGTAGACTACAGCAATGAAGCTATGCAAAAAATGAGTTACACACTGCAA
CATGTTCCCATTCCCAGAAGCTGGAACCAGTGGAACTGTGTACCTCTGTGA
Protein Properties
Number of Residues 296
Molecular Weight 18506.33
Theoretical pI 8.703
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycine N-acyltransferase
MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCP
QEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
IKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAINQEMFKLSSMDVTHAHL
VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLH
GLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
GenBank ID Protein 111038137
UniProtKB/Swiss-Prot ID Q6IB77
UniProtKB/Swiss-Prot Entry Name GLYAT_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_201648.2
GeneCard ID GLYAT
GenAtlas ID GLYAT
HGNC ID HGNC:13734
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. van der Westhuizen FH, Pretorius PJ, Erasmus E: The utilization of alanine, glutamic acid, and serine as amino acid substrates for glycine N-acyltransferase. J Biochem Mol Toxicol. 2000;14(2):102-9. [PubMed:10630424 ]
  4. Mawal YR, Qureshi IA: Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver. Biochem Biophys Res Commun. 1994 Dec 15;205(2):1373-9. [PubMed:7802672 ]