You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07352
Secondary Accession Numbers
  • 12974
Name Glycine N-acyltransferase-like protein 3
Synonyms Not Available
Gene Name GLYATL3
Protein Type Enzyme
Biological Properties
General Function Involved in glycine N-acyltransferase activity
Specific Function Acyltransferase which transfers the acyl group to the N- terminus of glycine
Pathways Not Available
Reactions Not Available
GO Classification
Component
mitochondrion
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
glycine n-acyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
n-acyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6p12.3
SNPs GLYATL3
Gene Sequence
>867 bp
ATGTTGGTGCTAAACTGTTCTACCAAATTACTGATACTGGAGAAAATGTTGAAGAGTTGC
TTTCCTGAATCACTCAAGGTTTACGGAGCGGTGATGAACATAAATCGTGGGAACCCCTTT
CAAAAGGAAGTGGTGTTGGATTCATGGCCGGATTTCAAAGCTGTTATCACCCGACGACAA
AGAGAGGCTGAGACAGATAACCTTGATCATTATACTAATGCCTATGCTGTGTTCTACAAG
GATGTCAGGGCTTATCGACAGCTATTGGAAGAATGTGATGTTTTTAACTGGGACCAAGTT
TTTCAAATACAAGGGCTGCAGAGTGAGTTATATGATGTTTCCAAAGCGGTTGCCAATTCA
AAGCAGTTGAATATAAAGCTAACTTCCTTCAAGGCTGTTCATTTTTCTCCTGTTTCATCT
CTGCCAGATACCAGTTTCCTCAAGGGGCCTTCCCCACGACTAACCTACCTGAGTGTTGCC
AATGCGGATCTACTCAACCGGACTTGGTCCCGGGGAGGCAATGAACAATGTCTCCGGTAC
ATCGCCAACCTCATCTCCTGCTTCCCTAGTGTGTGTGTCCGGGATGAGAAGGGAAACCCG
GTCTCCTGGTCCATCACAGACCAGTTTGCCACCATGTGCCATGGCTACACCCTGCCAGAA
CATCGCAGGAAAGGTTACAGCCGGCTGGTGGCCCTCACGCTGGCCAGGAAGTTGCAAAGC
CGGGGATTCCCCTCTCAGGGGAACGTCCTGGATGACAACACGGCGTCTATAAGCCTCCTG
AAGAGTCTCCATGCTGAGTTCTTGCCTTGTCGCTTCCACAGGCTTATTCTCACCCCTGCG
ACTTTCTCTGGCCTGCCTCACCTCTAG
Protein Properties
Number of Residues 288
Molecular Weight 32703.3
Theoretical pI 9.04
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Glycine N-acyltransferase-like protein 3
MLVLNCSTKLLILEKMLKSCFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAVITRRQ
REAETDNLDHYTNAYAVFYKDVRAYRQLLEECDVFNWDQVFQIQGLQSELYDVSKAVANS
KQLNIKLTSFKAVHFSPVSSLPDTSFLKGPSPRLTYLSVANADLLNRTWSRGGNEQCLRY
IANLISCFPSVCVRDEKGNPVSWSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQS
RGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILTPATFSGLPHL
GenBank ID Protein 222831633
UniProtKB/Swiss-Prot ID Q5SZD4
UniProtKB/Swiss-Prot Entry Name GLYL3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001010904.1
GeneCard ID GLYATL3
GenAtlas ID GLYATL3
HGNC ID HGNC:21349
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]