You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07377
Secondary Accession Numbers
  • 13033
Name Methionyl-tRNA formyltransferase, mitochondrial
Synonyms
  1. MtFMT
Gene Name MTFMT
Protein Type Enzyme
Biological Properties
General Function Involved in methionyl-tRNA formyltransferase activity
Specific Function Formylates methionyl-tRNA in mitochondria. A single tRNA(Met) gene gives rise to both an initiator and an elongator species via an unknown mechanism (By similarity).
Pathways
  • Aminoacyl-tRNA biosynthesis
  • Cystathionine Beta-Synthase Deficiency
  • Folate malabsorption, hereditary
  • Folate Metabolism
  • Glycine N-methyltransferase Deficiency
  • Homocystinuria-megaloblastic anemia due to defect in cobalamin metabolism, cblG complementation type
  • Hypermethioninemia
  • Methionine Adenosyltransferase Deficiency
  • Methionine Metabolism
  • Methotrexate Action Pathway
  • Methylenetetrahydrofolate Reductase Deficiency (MTHFRD)
  • Methylenetetrahydrofolate Reductase Deficiency (MTHFRD)
  • One carbon pool by folate
  • S-Adenosylhomocysteine (SAH) Hydrolase Deficiency
Reactions
10-Formyltetrahydrofolate + L-methionyl-tRNA(fMet) → Tetrahydrofolic acid + N-formylmethionyl-tRNA(fMet) details
L-Methionyl-tRNA + 10-Formyltetrahydrofolate → Tetrahydrofolic acid + N-Formylmethionyl-tRNA details
GO Classification
Biological Process
translational initiation
Cellular Component
mitochondrion
Function
methionyl-trna formyltransferase activity
catalytic activity
transferase activity
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
methyltransferase activity
methionyl-tRNA formyltransferase activity
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
biosynthetic process
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 15
Locus 15q22.31
SNPs MTFMT
Gene Sequence
>1170 bp
ATGAGGGTGTTGGTGCGGCGCTGTTGGGGTCCTCCGCTGGCTCATGGCGCCAGGCGTGGG
AGGCCGAGTCCCCAGTGGCGAGCACTGGCCCGACTCGGCTGGGAGGACTGCCGGGACTCC
AGAGTCCGCGAGAAGCCTCCCTGGCGGGTGCTCTTCTTCGGCACGGACCAGTTCGCCCGC
GAGGCGCTGCGGGCGCTGCACGCCGCCAGGGAAAACAAAGAAGAAGAGTTAATCGACAAA
CTGGAGGTGGTCACAATGCCTTCCCCATCACCAAAAGGACTGCCAGTGAAGCAATATGCT
GTGCAGTCTCAGCTTCCCGTATATGAGTGGCCGGATGTGGGATCTGGAGAATATGATGTT
GGAGTAGTGGCTTCGTTTGGCCGACTTTTGAATGAGGCTCTTATTCTTAAATTTCCCTAT
GGCATATTGAATGTTCATCCCAGTTGCCTCCCGAGATGGCGTGGCCCAGCCCCTGTAATC
CATACAGTGCTTCACGGAGACACAGTTACTGGAGTAACAATTATGCAAATTAGACCTAAA
AGGTTTGATGTAGGCCCAATTCTCAAACAAGAAACTGTTCCTGTGCCACCCAAGAGCACT
GCAAAGGAATTGGAAGCAGTGTTGTCAAGACTGGGTGCCAACATGCTCATTTCAGTTTTG
AAAAATTTGCCTGAAAGTCTGAGCAATGGAAGGCAGCAGCCAATGGAGGGGGCGACTTAC
GCCCCTAAGATTTCTGCTGGTACCAGTTGTATAAAATGGGAGGAACAAACTTCAGAACAA
ATATTCAGACTTTACCGTGCCATTGGAAATATAATTCCGTTGCAGACGCTCTGGATGGCG
AATACCATTAAACTTCTGGATTTGGTAGAAGTTAACAGTTCAGTCCTTGCTGATCCAAAA
TTAACGGGACAGGCTCTTATTCCAGGATCAGTAATATACCACAAACAGTCACAAATACTA
TTGGTTTATTGCAAGGATGGTTGGATTGGTGTTCGATCAGTGATGCTCAAGAAATCACTA
ACAGCTACTGACTTCTACAATGGATATTTGCACCCCTGGTACCAGAAAAATTCCCAAGCT
CAACCAAGCCAATGCAGATTTCAGACTCTCAGACTTCCAACAAAGAAGAAGCAGAAAAAA
ACTGTTGCTATGCAACAATGCATTGAGTAG
Protein Properties
Number of Residues 389
Molecular Weight 43831.73
Theoretical pI 9.663
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Methionyl-tRNA formyltransferase, mitochondrial
MRVLVRRCWGPPLAHGARRGRPSPQWRALARLGWEDCRDSRVREKPPWRVLFFGTDQFAR
EALRALHAARENKEEELIDKLEVVTMPSPSPKGLPVKQYAVQSQLPVYEWPDVGSGEYDV
GVVASFGRLLNEALILKFPYGILNVHPSCLPRWRGPAPVIHTVLHGDTVTGVTIMQIRPK
RFDVGPILKQETVPVPPKSTAKELEAVLSRLGANMLISVLKNLPESLSNGRQQPMEGATY
APKISAGTSCIKWEEQTSEQIFRLYRAIGNIIPLQTLWMANTIKLLDLVEVNSSVLADPK
LTGQALIPGSVIYHKQSQILLVYCKDGWIGVRSVMLKKSLTATDFYNGYLHPWYQKNSQA
QPSQCRFQTLRLPTKKKQKKTVAMQQCIE
GenBank ID Protein 164663775
UniProtKB/Swiss-Prot ID Q96DP5
UniProtKB/Swiss-Prot Entry Name FMT_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_139242.3
GeneCard ID MTFMT
GenAtlas ID MTFMT
HGNC ID HGNC:29666
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]