You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07384
Secondary Accession Numbers
  • 13044
Name Glycerate kinase
Synonyms
  1. HBeAg-binding protein 4
Gene Name GLYCTK
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Not Available
Pathways
  • 3-Phosphoglycerate dehydrogenase deficiency
  • D-glyceric acidura
  • Dihydropyrimidine Dehydrogenase Deficiency (DHPD)
  • Dimethylglycine Dehydrogenase Deficiency
  • Dimethylglycine Dehydrogenase Deficiency
  • Familial lipoprotein lipase deficiency
  • Glycerol Kinase Deficiency
  • Glycerolipid metabolism
  • Glycerolipid Metabolism
  • Glycine and Serine Metabolism
  • Glycine, serine and threonine metabolism
  • Glyoxylate and dicarboxylate metabolism
  • Hyperglycinemia, non-ketotic
  • Non Ketotic Hyperglycinemia
  • Sarcosinemia
Reactions
Adenosine triphosphate + Glyceric acid → ADP + 3-Phosphoglyceric acid details
GO Classification
Biological Process
protein phosphorylation
Cellular Component
mitochondrion
Golgi apparatus
Molecular Function
ATP binding
glycerate kinase activity
Cellular Location
  1. Mitochondrion
  2. Isoform 2:Cytoplasm
Gene Properties
Chromosome Location 3
Locus 3p21.1
SNPs GLYCTK
Gene Sequence
>1572 bp
ATGGCTGCAGCCCTGCAGGTCCTGCCCCGCTTGGCCCGAGCCCCCTTGCATCCACTCCTC
TGGCGGGGCTCAGTGGCCCGTCTGGCCAGCAGCATGGCCTTGGCAGAGCAGGCCAGGCAG
CTGTTTGAGAGTGCTGTAGGTGCAGTGCTGCCGGGCCCCATGCTGCACCGGGCACTATCC
TTGGACCCTGGTGGCAGACAGCTGAAGGTGCGGGACCGGAACTTTCAGCTGAGGCAAAAC
CTCTACCTGGTGGGCTTTGGCAAGGCTGTGCTGGGTATGGCAGCTGCAGCTGAGGAACTA
CTGGGCCAGCATCTTGTGCAGGGCGTGATCAGCGTTCCCAAGGGGATCCGTGCTGCCATG
GAGCGTGCCGGCAAGCAGGAGATGCTGCTGAAGCCACATAGCCGTGTCCAGGTATTCGAG
GGTGCGGAGGACAACCTCCCGGACCGCGATGCGCTGCGGGCTGCACTGGCCATCCAGCAA
CTGGCTGAGGGACTCACAGCTGATGACCTGCTGCTCGTGCTGATCTCAGGTGGGGGTTCA
GCTCTGCTGCCTGCCCCCATCCCACCTGTCACACTGGAGGAGAAGCAGACACTCACTAGA
CTGCTGGCAGCCCGTGGAGCCACCATCCAGGAGTTGAACACCATTCGGAAGGCCCTGTCC
CAGCTCAAGGGTGGGGGGCTGGCTCAGGCCGCCTACCCTGCCCAGGTGGTGAGCCTCATC
CTGTCAGATGTGGTGGGGGACCCTGTGGAGGTGATTGCCAGTGGCCCCACCGTGGCCAGT
TCCCACAATGTGCAAGATTGCCTGCATATCCTCAATCGCTACGGCCTCCGTGCAGCCCTG
CCACGTTCTGTGAAGACTGTGCTGTCTCGGGCCGACTCTGACCCCCATGGGCCACACACC
TGTGGCCATGTCCTGAATGTGATCATTGGCTCTAATGTGCTGGCGCTAGCTGAGGCCCAG
CGGCAGGCCGAGGCACTGGGCTACCAGGCTGTGGTGCTGAGTGCAGCCATGCAAGGTGAT
GTAAAAAGTATGGCCCAGTTCTACGGGCTGCTGGCCCATGTGGCTAGAACCCGCCTCACC
CCATCCATGGCTGGGGCTTCTGTGGAGGAAGATGCACAGCTCCATGAGCTGGCAGCTGAG
CTTCAGATCCCAGACCTGCAGCTGGAGGAGGCTCTGGAGACCATGGCATGGGGAAGGGGC
CCAGTCTGCCTGCTGGCTGGTGGCGAGCCCACAGTACAGCTGCAGGGCTCGGGCAGGGGT
GGCCGGAACCAGGAACTGGCCCTGCGTGTTGGAGCAGAGTTGAGAAGGTGGCCGCTGGGG
CCGATAGATGTGCTGTTTTTGAGCGGTGGCACCGATGGGCAGGATGGGCCCACAGAGGCT
GCTGGGGCCTGGGTCACACCTGAGCTTGCCAGCCAGGCTGCAGCTGAGGGCCTGGACATA
GCCACCTTCCTAGCCCACAATGACTCACATACCTTCTTCTGCTGCCTCCAGGGTGGGGCA
CACCTGCTGCACACAGGGATGACAGGTACCAATGTCATGGACACCCACCTCTTGTTCCTG
CGGCCTCGGTGA
Protein Properties
Number of Residues 523
Molecular Weight 25036.865
Theoretical pI 8.614
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycerate kinase
MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALS
LDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAM
ERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS
ALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLI
LSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGPHT
CGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLT
PSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDI
ATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR
GenBank ID Protein 30911055
UniProtKB/Swiss-Prot ID Q8IVS8
UniProtKB/Swiss-Prot Entry Name GLCTK_HUMAN
PDB IDs Not Available
GenBank Gene ID AF448855
GeneCard ID GLYCTK
GenAtlas ID GLYCTK
HGNC ID HGNC:24247
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]
  4. Guo JH, Hexige S, Chen L, Zhou GJ, Wang X, Jiang JM, Kong YH, Ji GQ, Wu CQ, Zhao SY, Yu L: Isolation and characterization of the human D-glyceric acidemia related glycerate kinase gene GLYCTK1 and its alternatively splicing variant GLYCTK2. DNA Seq. 2006 Feb;17(1):1-7. [PubMed:16753811 ]