Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07388
Secondary Accession Numbers
  • 13050
Name Glycerophosphodiester phosphodiesterase 1
Synonyms
  1. Membrane-interacting protein of RGS16
  2. RGS16-interacting membrane protein
Gene Name GDE1
Protein Type Unknown
Biological Properties
General Function Involved in glycerophosphodiester phosphodiesterase activity
Specific Function Has glycerophosphoinositol phosphodiesterase activity. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways (By similarity).
Pathways
  • Phospholipid Biosynthesis
Reactions
1-(sn-Glycero-3-phospho)-1D-myo-inositol + Water → myo-Inositol + Glycerol 3-phosphate details
GO Classification
Biological Process
glycerol metabolic process
lipid metabolic process
Cellular Component
cytoplasm
integral to membrane
Function
glycerophosphodiester phosphodiesterase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
Molecular Function
metal ion binding
glycerophosphodiester phosphodiesterase activity
glycerophosphoinositol glycerophosphodiesterase activity
Process
metabolic process
primary metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
lipid metabolic process
Cellular Location
  1. Cytoplasm
  2. Membrane
  3. Multi- pass membrane protein
Gene Properties
Chromosome Location 16
Locus 16p12-p11.2
SNPs GDE1
Gene Sequence
>996 bp
ATGTGGCTGTGGGAGGACCAGGGCGGCCTCCTGGGCCCTTTCTCCTTCCTGCTGCTAGTG
CTGCTGCTGGTGACGCGGAGCCCGGTCAATGCCTGCCTCCTCACCGGCAGCCTCTTCGTT
CTACTGCGCGTCTTCAGCTTTGAGCCGGTGCCCTCTTGCAGGGCCCTGCAGGTGCTCAAG
CCCCGGGACCGCATTTCTGCCATCGCCCACCGTGGCGGCAGCCACGACGCGCCCGAGAAC
ACGCTGGCGGCCATTCGGCAGGCAGCTAAGAATGGAGCAACAGGCGTGGAGTTGGACATT
GAGTTTACTTCTGACGGGATTCCTGTCTTAATGCACGATAACACAGTAGATAGGACGACT
GATGGGACTGGGCGATTGTGTGATTTGACATTTGAACAAATTAGGAAGCTGAATCCTGCA
GCAAACCACAGACTCAGGAATGATTTCCCTGATGAAAAGATCCCTACCCTAAGGGAAGCT
GTTGCAGAGTGCCTAAACCATAACCTCACAATCTTCTTTGATGTCAAAGGCCATGCACAC
AAGGCTACTGAGGCTCTAAAGAAAATGTATATGGAATTTCCTCAACTGTATAATAATAGT
GTGGTCTGTTCTTTCTTGCCAGAAGTTATCTACAAGATGAGACAAACAGATCGGGATGTA
ATAACAGCATTAACTCACAGACCTTGGAGCCTAAGCCATACAGGAGATGGGAAACCACGC
TATGATACTTTCTGGAAACATTTTATATTTGTTATGATGGACATTTTGCTCGATTGGAGC
ATGCATAATATCTTGTGGTACCTGTGTGGAATTTCAGCTTTCCTCATGCAAAAGGATTTT
GTATCCCCGGCCTACTTGAAGAAGTGGTCAGCTAAAGGAATCCAGGTTGTTGGTTGGACT
GTTAATACCTTTGATGAAAAGAGTTACTACGAATCCCATCTTGGTTCCAGCTATATCACT
GACAGCATGGTAGAAGACTGCGAACCTCACTTCTAG
Protein Properties
Number of Residues 331
Molecular Weight 37718.04
Theoretical pI 6.706
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycerophosphodiester phosphodiesterase 1
MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLK
PRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAH
KATEALKKMYMEFPQLYNNSVVCSFLPEVIYKMRQTDRDVITALTHRPWSLSHTGDGKPR
YDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDFVSPAYLKKWSAKGIQVVGWT
VNTFDEKSYYESHLGSSYITDSMVEDCEPHF
GenBank ID Protein 7637877
UniProtKB/Swiss-Prot ID Q9NZC3
UniProtKB/Swiss-Prot Entry Name GDE1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF212862
GeneCard ID GDE1
GenAtlas ID GDE1
HGNC ID HGNC:29644
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829 ]
  3. Zheng B, Chen D, Farquhar MG: MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16. Proc Natl Acad Sci U S A. 2000 Apr 11;97(8):3999-4004. [PubMed:10760272 ]
  4. Bachmann AS, Duennebier FF, Mocz G: Genomic organization, characterization, and molecular 3D model of GDE1, a novel mammalian glycerophosphoinositol phosphodiesterase. Gene. 2006 Apr 12;371(1):144-53. Epub 2006 Feb 9. [PubMed:16472945 ]