You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07419
Secondary Accession Numbers
  • 13121
Name 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
Synonyms
  1. Ubiquinone biosynthesis methyltransferase COQ5
Gene Name COQ5
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2) (By similarity).
Pathways
  • Ubiquinone and other terpenoid-quinone biosynthesis
  • ubiquinone biosynthesis
  • Ubiquinone Biosynthesis
Reactions
S-Adenosylmethionine + 2-methoxy-6-all-trans-polyprenyl-1,4-benzoquinol → S-Adenosylhomocysteine + 6-methoxy-3-methyl-2-all-trans-polyprenyl-1,4-benzoquinol details
2-Hexaprenyl-6-methoxy-1,4-benzoquinone + S-Adenosylmethionine → 2-Hexaprenyl-3-methyl-6-methoxy-1,4 benzoquinone + S-Adenosylhomocysteine details
2-Polyprenyl-6-methoxy-1,4-benzoquinone + S-Adenosylmethionine → 2-Polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone + S-Adenosylhomocysteine details
GO Classification
Biological Process
ubiquinone biosynthetic process
Cellular Component
mitochondrion
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
methyltransferase activity
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 12
Locus 12q24.31
SNPs COQ5
Gene Sequence
>984 bp
ATGGCGGCCCCCGGGAGCTGTGCTCTATGGAGCTATTGCGGCCGTGGGTGGTCGCGGGCG
ATGCGGGGCTGCCAGCTCCTCGGGCTTCGTAGCTCTTGGCCCGGGGACCTACTAAGTGCT
CGGCTCTTGTCCCAAGAGAAGCGGGCAGCGGAAACGCACTTTGGGTTTGAGACTGTGTCG
GAAGAGGAGAAGGGGGGCAAAGTCTATCAGGTGTTTGAAAGTGTGGCTAAGAAGTATGAT
GTGATGAATGATATGATGAGTCTTGGTATCCATCGTGTTTGGAAGGATTTGCTGCTCTGG
AAGATGCACCCGCTTCCTGGGACCCAGCTGCTTGATGTTGCTGGAGGCACAGGTGACATT
GCATTCCGGTTCCTTAATTATGTTCAGTCCCAGCATCAGAGAAAACAGAAGAGGCAGTTA
AGGGCCCAACAAAATTTATCCTGGGAAGAAATTGCCAAAGAGTACCAGAATGAAGAAGAT
TCCTTGGGCGGGTCTCGTGTCGTGGTGTGTGACATCAACAAGGAGATGCTAAAGGTTGGA
AAGCAGAAAGCCTTGGCTCAAGGATACAGAGCTGGACTTGCATGGGTATTAGGAGATGCT
GAAGAACTGCCCTTTGATGATGACAAGTTTGATATTTACACCATTGCCTTTGGGATCCGG
AATGTCACACACATTGATCAGGCACTCCAGGAAGCTCATCGGGTGCTGAAACCAGGAGGA
CGGTTTCTCTGTCTGGAATTTAGCCAAGTGAACAATCCCCTCATATCCAGGCTTTATGAT
CTATATAGCTTCCAGGTCATCCCTGTCCTGGGAGAGGTCATCGCTGGAGACTGGAAGTCC
TATCAGTACCTTGTAGAGAGTATCCGAAGGTTTCCGTCTCAGGAAGAGTTCAAGGACATG
ATAGAAGATGCAGGCTTTCACAAGGTGACTTACGAAAGTCTAACATCAGGCATTGTGGCC
ATTCATTCTGGCTTCAAACTTTAA
Protein Properties
Number of Residues 327
Molecular Weight 37140.17
Theoretical pI 6.942
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVS
EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDI
AFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVG
KQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGG
RFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDM
IEDAGFHKVTYESLTSGIVAIHSGFKL
GenBank ID Protein 116063536
UniProtKB/Swiss-Prot ID Q5HYK3
UniProtKB/Swiss-Prot Entry Name COQ5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032314.3
GeneCard ID COQ5
GenAtlas ID COQ5
HGNC ID HGNC:28722
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]