You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07437
Secondary Accession Numbers
  • 13145
Name A-kinase anchor protein 13
Synonyms
  1. AKAP-13
  2. AKAP-Lbc
  3. Breast cancer nuclear receptor-binding auxiliary protein
  4. Guanine nucleotide exchange factor Lbc
  5. Human thyroid-anchoring protein 31
  6. LBC oncogene
  7. Lymphoid blast crisis oncogene
  8. Non-oncogenic Rho GTPase-specific GTP exchange factor
  9. Protein kinase A-anchoring protein 13
  10. p47
Gene Name AKAP13
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Anchors cAMP-dependent protein kinase (PKA) and acts as an adapter protein to selectively couple G alpha-13 and Rho. Augments gene activation by the estrogen receptor in an element- specific and ligand-dependent manner. Activates estrogen receptor beta by a p38 MAPK-dependent pathway. Isoform 6 stimulates exchange activity on Rho proteins in vitro, but not on CDC42, Ras or Rac and may bind calcium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Isoform 7:Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q24-q25
SNPs AKAP13
Gene Sequence
>8442 bp
ATGAAACTTAATCCACAGCAAGCTCCCTTATATGGTGATTGTGTTGTTACAGTGCTGCTT
GCTGAAGAGGACAAAGCTGAAGATGATGTAGTGTTTTACTTGGTATTTTTGGGTTCCACC
CTCCGTCACTGTACAAGTACTCGGAAGGTCAGTTCTGATACATTGGAGACCATTGCTCCT
GGTCATGATTGTTGTGAAACAGTGAAGGTGCAGCTCTGTGCTTCCAAAGAGGGCCTTCCC
GTGTTTGTGGTGGCTGAAGAAGACTTTCATTTCGTCCAGGATGAAGCGTATGATGCAGCT
CAATTCCTAGCAACCAGTGCTGGAAATCAGCAGGCTTTGAACTTTACCCGTTTTCTTGAC
CAGTCAGGACCCCCATCTGGGGATGTGAATTCCCTTGATAAGAAGTTGGTGCTGGCATTC
AGGCACCTGAAGCTGCCCACGGAGTGGAATGTATTGGGGACAGATCAGAGTTTGCATGAT
GCTGGCCCGCGAGAGACATTGATGCATTTTGCTGTGCGGCTGGGACTGCTGAGGTTGACG
TGGTTCCTGTTGCAGAAGCCAGGTGGCCGCGGAGCTCTCAGTATCCACAACCAGGAAGGG
GCGACGCCTGTGAGCTTGGCCTTGGAGCGAGGCTATCACAAGCTGCACCAGCTTCTAACC
GAGGAGAATGCTGGAGAACCAGACTCCTGGAGCAGTTTATCCTATGAAATACCGTATGGA
GACTGTTCTGTGAGGCATCATCGAGAGTTGGACATCTATACATTAACCTCTGAGTCTGAT
TCACATCATGAACACCCATTTCCTGGAGACGGTTGCACTGGACCAATTTTTAAACTTATG
AACATCCAACAGCAACTAATGAAAACAAACCTCAAGCAGATGGACAGTCTTATGCCCTTA
ATGATGACAGCACAGGATCCTTCCAGTGCCCCAGAGACAGATGGCCAGTTTCTTCCCTGT
GCACCGGAGCCCACGGACCCTCAGCGACTTTCTTCTTCTGAAGAGACTGAGAGCACTCAG
TGCTGCCCAGGGAGCCCTGTTGCACAGACTGAAAGTCCCTGTGATTTGTCAAGCATAGTT
GAGGAGGAGAATACAGACCGTTCCTGTAGGAAGAAAAATAAAGGCGTGGAAAGAAAAGGG
GAAGAGGTGGAGCCAGCACCTATTGTGGACTCTGGAACTGTATCTGATCAAGACAGCTGC
CTTCAGAGCTTGCCTGATTGTGGAGTAAAGGGCACGGAAGGCCTTTCGTCCTGTGGAAAC
AGAAATGAAGAAACTGGAACAAAATCTTCTGGAATGCCCACAGACCAGGAGTCCCTGAGC
AGTGGAGATGCTGTGCTTCAGAGAGACTTGGTCACGGAGCCAGGCACAGCCCAGTATTCC
TCTGGAGGTGAACTGGGAGGCATTTCAACAACAAATGTCAGTACCCCAGACACTGCAGGG
GAAATGGAACATGGGCTCATGAACCCAGATGCCACTGTTCGGAAGAATGTGCTTCAGGGA
GGGGAAAGTACAAAGGAAAGATTTGAGAACTCTAATATTGGCACAGCTGGAGCCTCTGAC
GTGCACGTCACAAGTAAGCCTGTGGATAAAATCAGTGTTCCAAACTGTGCCCCTGCCGCC
AGTTCCCTGGATGGTAACAAACCTGCTGAGTCTTCACTTGCATTTAGTAATGAAGAAACC
TCCACTGAAAAAACAGCAGAAACGGAAACTTCACGAAGTTGTGAGGAGAGTGCTGATGCT
CCAGTAGATCAGAATTCTGTGGTGATTCCAGCTGCTGCAAAAGACAAGATTTCAGATGGA
TTAGAACCTTATACTCTCTTAGCAGCAGGCATAGGTGAGGCAATGTCACCCTCAGATTTA
GCCCTTCTTGGGCTGGAAGAAGATGTAATGCCACACCAGAACTCAGAAACAAATTCATCT
CATGCTCAAAGCCAAAAGGGCAAATCCTCACCCATTTGTTCTACAACTGGAGACGATAAA
CTTTGTGCAGACTCTGCATGTCAACAGAACACAGTGACTTCTAGTGGCGATTTGGTTGCA
AAACTGTGTGATAACATAGTTAGCAAGTCCGAAAGCACCACAGCAAGGCAACCCAGCTCA
CAAGATCCACCCGATGCCTCCCACTGTGAAGACCCACAGGCTCATACAGTCACCTCTGAC
CCTGTAAGGGATACCCAGGAACGTGCGGATTTTTGTCCTTTCAAAGTGGTGGATAACAAA
GGCCAACGAAAAGATGTGAAACTAGATAAACCTTTAACAAATATGCTTGAGGTGGTTTCA
CATCCACATCCAGTTGTCCCTAAAATGGAGAAAGAACTGGTGCCAGACCAGGCAGTAATA
TCAGACAGTACTTTCTCTCTGGCAAACAGTCCAGGCAGTGAATCAGTAACCAAGGATGAC
GCACTTTCTTTTGTCCCCTCCCAGAAAGAAAAGGGAACAGCAACTCCTGAACTACATACA
GCTACAGATTATAGAGATGGCCCAGATGGAAATTCGAATGAGCCTGATACGCGGCCACTA
GAAGACAGGGCAGCAGGCCTGTCCACATCCTCCACTGCTGCAGAGCTTCAGCACGGGATG
GGGAATACCAGTCTCACAGGACTTGGTGGAGAGCATGAGGGTCCTGCCCCTCCAGCAATC
CCAGAAGCTCTGAATATCAAGGGGAACACTGACTCTTCCCTGCAAAGTATGGGTAAGGCC
ACTTTGGCTTTAGATTCAGTTTTGACTGAAGAAGGAAAACTTCTGGTGGTTTCAGAAAGC
TCTGCAGCTCAGGAACAAGATAAGGATAAAGCGGTGACCTGTTCCTCTATTAAGGAAAAT
GCTCTCTCTTCAGGAACTTTGCAGGAAGAGCAGAGAACACCACCTCCTGGACAAGATACT
CAACAATTTCATGAAAAATCAATCTCAGCTGACTGTGCCAAGGACAAAGCACTTCAGCTA
AGTAATTCACCGGGTGCATCCTCTGCCTTTCTTAAGGCAGAAACTGAACATAACAAGGAA
GTGGCCCCACAAGTCTCACTGCTGACTCAAGGTGGGGCTGCCCAGAGCCTGGTGCCACCA
GGAGCAAGTCTGGCCACAGAGTCAAGGCAGGAAGCCTTGGGGGCAGAGCACAACAGCTCC
GCTCTGTTGCCATGTCTGTTGCCAGATGGGTCTGATGGGTCCGATGCTCTTAACTGCAGT
CAGGCTTCTCCTCTGGATGTTGGAGTGAAGAACACTCAATCCCAGGGAAAAACTAGTGCC
TGTGAGGTGAGTGGAAATGTGACGGTGGATGTTACAGGGGTTAATGCTCTACAAGGTATG
GCTGAGCCCAGAAGAGAGAATATATCACACAACACCCAAGACATCCTGATTCCAAACGTC
TTGTTGAGCCAAGAGAAGAATGCCGTTCTAGGTTTGCCAGTGGCTCTACAGGACAAAGCT
GTGACTGACCCACAGGGAGTTGGAACCCCAGAGATGATACCTCTTGATTGGGAGAAAGGG
AAGCTGGAGGGAGCAGACCACAGCTGTACCATGGGTGACGCTGAGGAAGCCCAAATAGAC
GATGAAGCACATCCTGTCCTACTGCAGCCTGTTGCCAAGGAGCTCCCCACAGACATGGAG
CTCTCAGCCCATGATGATGGGGCCCCAGCTGGTGTGAGGGAAGTCACGCGAGCCCCGCCT
TCAGGCAGAGAAAGGAGCACTCCCTCTCTACCTTGCATGGTCTCTGCCCAGGACGCACCT
CTGCCTAAGGGGGCAGACTTGATAGAGGAGGCTGCCAGCCGTATAGTGGATGCTGTCATC
GAACAAGTCAAGGCCGCTGGAGCACTGCTTACTGAGGGGGAGGCCTGTCACATGTCACTG
TCCAGCCCTGAGTTGGGTCCTCTCACTAAAGGACTAGAGAGTGCTTTTACAGAAAAAGTG
AGTACTTTCCCACCTGGGGAGAGCCTACCAATGGGCAGTACTCCTGAGGAAGCCACGGGG
AGCCTTGCAGGATGTTTTGCTGGAAGGGAGGAGCCAGAGAAGATCATTTTACCTGTCCAG
GGGCCTGAGCCAGCAGCAGAAATGCCAGACGTGAAAGCTGAAGATGAAGTGGATTTTAGA
GCAAGTTCAATTTCTGAAGAAGTGGCTGTAGGGAGCATAGCTGCTACACTGAAGATGAAG
CAAGGCCCAATGACCCAGGCGATAAACCGAGAAAACTGGTGTACAATAGAGCCATGCCCT
GATGCAGCATCTCTTCTGGCTTCCAAGCAGAGCCCAGAATGTGAGAACTTCCTGGATGTT
GGACTGGGCAGAGAGTGTACCTCAAAACAAGGTGTACTTAAAAGAGAATCTGGGAGTGAT
TCTGACCTCTTTCACTCACCCAGTGATGACATGGACAGCATCATCTTCCCAAAGCCAGAG
GAAGAGCATTTGGCCTGTGATATCACCGGATCCAGTTCATCCACCGATGACACGGCTTCA
CTGGACCGACATTCTTCTCATGGCAGTGATGTGTCTCTCTCCCAGATTTTAAAGCCAAAC
AGGTCAAGAGATCGGCAAAGCCTTGATGGATTCTACAGCCATGGGATGGGAGCTGAGGGT
CGAGAAAGTGAGAGTGAGCCTGCTGACCCAGGCGACGTGGAGGAGGAGGAGATGGACAGT
ATCACTGAAGTGCCTGCAAACTGCTCTGTCCTAAGGAGCTCCATGCGCTCTCTTTCTCCC
TTCCGGAGGCACAGCTGGGGGCCTGGGAAAAATGCAGCCAGCGATGCAGAAATGAACCAC
CGGAGTTCAATGCGAGTTCTTGGGGATGTTGTCAGGAGACCTCCCATTCATAGGAGAAGT
TTCAGTCTAGAAGGCTTGACAGGAGGAGCTGGTGTCGGAAACAAGCCATCCTCATCTCTA
GAAGTAAGCTCTGCAAATGCCGAAGAGCTCAGACACCCATTCAGTGGTGAGGAACGGGTT
GACTCTTTGGTGTCACTTTCAGAAGAGGATCTGGAGTCAGACCAGAGAGAACATAGGATG
TTTGATCAGCAGATATGTCACAGATCTAAGCAGCAGGGATTTAATTACTGTACATCAGCC
ATTTCCTCTCCATTGACAAAATCCATCTCATTAATGACAATCAGCCATCCTGGATTGGAC
AATTCACGGCCCTTCCACAGTACCTTCCACAATACCAGTGCTAATCTGACTGAGAGTATA
ACAGAAGAGAACTATAATTTCCTGCCACATAGCCCCTCCAAGAAAGATTCTGAATGGAAG
AGTGGAACAAAAGTCAGTCGTACATTCAGCTACATCAAGAATAAAATGTCTAGCAGCAAG
AAGAGCAAAGAAAAGGAAAAAGAAAAAGATAAGATTAAGGAGAAGGAGAAAGATTCTAAA
GACAAGGAGAAAGATAAGAAGACTGTCAACGGGCACACTTTCAGTTCCATTCCTGTTGTG
GGTCCCATCAGCTGTAGCCAGTGTATGAAGCCCTTCACCAACAAAGATGCCTATACTTGT
GCAAATTGCAGTGCTTTTGTCCACAAAGGCTGCCGAGAAAGTCTAGCCTCCTGTGCAAAG
GTCAAAATGAAGCAGCCCAAAGGGAGCCTTCAGGCACATGACACATCATCACTGCCCACG
GTCATTATGAGAAACAAGCCCTCACAGCCCAAGGAGCGTCCTCGGTCCGCAGTCCTCCTG
GTGGATGAAACCGCTACCACCCCAATATTTGCCAATAGACGATCCCAGCAGAGTGTCTCG
CTCTCCAAAAGTGTCTCCATACAGAACATTACTGGAGTTGGCAATGATGAGAACATGTCA
AACACCTGGAAATTCCTGTCTCATTCAACAGACTCACTAAATAAAATCAGCAAGGTCAAT
GAGTCAACAGAATCACTTACTGATGAGGGAGTAGGTACAGACATGAATGAAGGACAACTA
CTGGGAGACTTTGAGATTGAGTCCAAACAGCTGGAAGCAGAGTCTTGGAGTCGGATAATA
GACAGCAAGTTTCTAAAACAGCAAAAGAAAGATGTGGTCAAACGGCAAGAAGTAATATAT
GAGTTGATGCAGACAGAGTTTCATCATGTCCGCACTCTCAAGATCATGAGTGGTGTGTAC
AGCCAGGGGATGATGGCGGATCTGCTTTTTGAGCAGCAGATGGTAGAAAAGCTGTTCCCC
TGTTTGGATGAGCTGATCAGTATCCATAGCCAATTCTTCCAGAGGATTCTGGAGCGGAAG
AAGGAGTCTCTGGTGGATAAAAGTGAAAAGAACTTTCTCATCAAGAGGATAGGGGATGTG
CTTGTAAATCAGTTTTCAGGTGAGAATGCAGAACGTTTAAAGAAGACATATGGCAAGTTT
TGTGGGCAACATAACCAGTCTGTAAACTACTTCAAAGACCTTTATGCCAAGGATAAGCGT
TTTCAAGCCTTTGTAAAGAAGAAGATGAGCAGTTCAGTTGTTAGAAGGCTTGGAATTCCA
GAGTGCATATTGCTTGTAACTCAGCGGATTACCAAGTACCCAGTTTTATTCCAAAGAATA
TTGCAGTGTACCAAAGACAATGAAGTGGAGCAGGAAGATCTAGCACAGTCCTTGAGCCTG
GTGAAGGATGTGATTGGAGCTGTAGACAGCAAAGTGGCAAGTTATGAAAAGAAAGTGCGT
CTCAATGAGATTTATACAAAGACAGATAGCAAGTCAATCATGAGGATGAAGAGTGGTCAG
ATGTTTGCCAAGGAAGATTTGAAACGGAAGAAGCTTGTACGTGATGGGAGTGTGTTTCTG
AAGAATGCAGCAGGAAGGTTGAAAGAGGTTCAAGCAGTTCTTCTCACTGACATTTTAGTT
TTCCTTCAAGAAAAAGACCAGAAGTACATCTTTGCATCATTGGACCAGAAGTCAACAGTG
ATCTCTTTAAAGAAGCTGATTGTGAGAGAAGTGGCACATGAGGAGAAAGGTTTATTCCTG
ATCAGCATGGGGATGACAGATCCAGAGATGGTAGAAGTCCATGCCAGCTCCAAAGAGGAA
CGAAACAGCTGGATTCAGATCATTCAGGACACAATCAACACCCTGAACAGAGATGAAGAT
GAAGGAATTCCTAGTGAGAATGAGGAAGAAAAGAAAATGTTGGACACCAGAGCCCGAGAA
TTAAAAGAACAACTTCACCAGAAGGACCAAAAAATCCTACTCTTGTTGGAAGAGAAGGAG
ATGATTTTCCGGGACATGGCTGAGTGCAGCACCCCTCTCCCAGAGGATTGCTCCCCAACA
CATAGCCCTAGAGTTCTCTTCCGCTCCAACACAGAAGAGGCTCTCAAAGGAGGACCTTTA
ATGAAAAGTGCAATAAATGAGGTGGAGATCCTTCAGGGTTTGGTGAGTGGAAATCTGGGA
GGCACACTTGGGCCGACTGTCAGCAGCCCCATTGAGCAAGATGTGGTCGGTCCCGTTTCC
CTGCCCCGGAGAGCAGAGACCTTTGGAGGATTTGACAGCCATCAGATGAATGCTTCAAAA
GGAGGCGAGAAGGAAGAGGGAGATGATGGCCAAGATCTTAGGAGAACGGAATCAGATAGT
GGCCTAAAAAAGGGTGGAAATGCTAACCTGGTATTTATGCTTAAAAGAAACAGTGAGCAG
GTTGTCCAGAGCGTTGTTCATCTCTACGAGCTCCTCAGCGCTCTGCAGGGTGTGGTGCTG
CAGCAGGACAGCTACATTGAGGACCAGAAACTGGTGCTGAGCGAGAGGGCGCTCACTCGC
AGCTTGTCCCGCCCGAGCTCCCTCATTGAGCAGGAGAAGCAGCGCAGCCTGGAGAAGCAG
CGCCAGGACCTGGCCAACCTGCAGAAGCAGCAGGCCCAGTACCTCGAGGAGAAGCGCAGG
CGCGAGCGTGAGTGGGAAGCTCGTGAGAGGGAGCTGCGGGAGCGGGAGGCCCTCCTGGCC
CAGCGCGAGGAGGAGGTGCAGCAGGGGCAGCAGGACCTGGAAAAGGAGCGGGAGGAGCTC
CAGCAGAAGAAGGGCACATACCAGTATGACCTGGAGCGACTGCGTGCTGCCCAGAAACAG
CTTGAGAGGGAACAGGAGCACGTGCGCCGGGAGGCAGAGCGGCTCAGCCAGCGGCAGACA
GAACGGGACCTGTGTCAGGTTTCCCATCCACATACCAAGCTGATGAGGATCCCATCGTTC
TTCCCCAGTCCTGAGGAGCCCCCCTCGCCATCTGCACCTTCCATAGCCAAATCAGGGTCA
TTGGACTCAGAACTTTCAGTGTCCCCAAAAAGGAACAGCATCTCTCGGACACACAAAGAT
AAGGGGCCTTTTCACATACTGAGTTCAACCAGCCAGACAAACAAAGGACCAGAAGGGCAG
AGCCAGGCCCCTGCGTCCACCTCTGCCTCTACCCGCCTGTTTGGGTTAACAAAGCCAAAG
GAAAAGAAGGAGAAAAAAAAGAAGAACAAAACCAGCCGCTCTCAGCCCGGTGATGGTCCC
GCGTCAGAAGTATCAGCAGAGGGTGAAGAGATCTTCTGCTGA
Protein Properties
Number of Residues 2813
Molecular Weight 307547.7
Theoretical pI 4.88
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein 13
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPL
MMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIV
EEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAA
SSLDGNKPAESSLAFSNEETSTEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDG
LEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDK
LCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVI
SDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKA
TLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPP
GASLATESRQEALGAEHNSSALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSA
CEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNVLLSQEKNAVLGLPVALQDKA
VTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATG
SLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMK
QGPMTQAINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSD
SDLFHSPSDDMDSIIFPKPEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPN
RSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSP
FRRHSWGPGKNAASDAEMNHRSSMRVLGDVVRRPPIHRRSFSLEGLTGGAGVGNKPSSSL
EVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNYCTSA
ISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWK
SGTKVSRTFSYIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVV
GPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPT
VIMRNKPSQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNITGVGNDENMS
NTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIESKQLEAESWSRII
DSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFP
CLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKF
CGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRI
LQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQ
MFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTV
ISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDED
EGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTPLPEDCSPT
HSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVS
LPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQ
VVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEKQ
RQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKEREEL
QQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSF
FPSPEEPPSPSAPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTSQTNKGPEGQ
SQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGPASEVSAEGEEIFC
GenBank ID Protein 15207794
UniProtKB/Swiss-Prot ID Q12802
UniProtKB/Swiss-Prot Entry Name AKP13_HUMAN
PDB IDs Not Available
GenBank Gene ID AB055890
GeneCard ID AKAP13
GenAtlas ID AKAP13
HGNC ID HGNC:371
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Iwashita S, Fujii M, Mukai H, Ono Y, Miyamoto M: Lbc proto-oncogene product binds to and could be negatively regulated by metastasis suppressor nm23-H2. Biochem Biophys Res Commun. 2004 Aug 6;320(4):1063-8. [PubMed:15249197 ]
  9. Driggers PH, Segars JH, Rubino DM: The proto-oncoprotein Brx activates estrogen receptor beta by a p38 mitogen-activated protein kinase pathway. J Biol Chem. 2001 Dec 14;276(50):46792-7. Epub 2001 Sep 28. [PubMed:11579095 ]
  10. Klussmann E, Edemir B, Pepperle B, Tamma G, Henn V, Klauschenz E, Hundsrucker C, Maric K, Rosenthal W: Ht31: the first protein kinase A anchoring protein to integrate protein kinase A and Rho signaling. FEBS Lett. 2001 Nov 2;507(3):264-8. [PubMed:11696353 ]
  11. Rubino D, Driggers P, Arbit D, Kemp L, Miller B, Coso O, Pagliai K, Gray K, Gutkind S, Segars J: Characterization of Brx, a novel Dbl family member that modulates estrogen receptor action. Oncogene. 1998 May 14;16(19):2513-26. [PubMed:9627117 ]
  12. Diviani D, Soderling J, Scott JD: AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho-mediated stress fiber formation. J Biol Chem. 2001 Nov 23;276(47):44247-57. Epub 2001 Sep 6. [PubMed:11546812 ]
  13. Toksoz D, Williams DA: Novel human oncogene lbc detected by transfection with distinct homology regions to signal transduction products. Oncogene. 1994 Feb;9(2):621-8. [PubMed:8290273 ]
  14. Sterpetti P, Hack AA, Bashar MP, Park B, Cheng SD, Knoll JH, Urano T, Feig LA, Toksoz D: Activation of the Lbc Rho exchange factor proto-oncogene by truncation of an extended C terminus that regulates transformation and targeting. Mol Cell Biol. 1999 Feb;19(2):1334-45. [PubMed:9891067 ]
  15. Carr DW, Hausken ZE, Fraser ID, Stofko-Hahn RE, Scott JD: Association of the type II cAMP-dependent protein kinase with a human thyroid RII-anchoring protein. Cloning and characterization of the RII-binding domain. J Biol Chem. 1992 Jul 5;267(19):13376-82. [PubMed:1618839 ]
  16. Newlon MG, Roy M, Morikis D, Carr DW, Westphal R, Scott JD, Jennings PA: A novel mechanism of PKA anchoring revealed by solution structures of anchoring complexes. EMBO J. 2001 Apr 2;20(7):1651-62. [PubMed:11285229 ]