Showing Protein Sodium/potassium-transporting ATPase subunit gamma (HMDBP07463)

• 13171

1. FXYD domain-containing ion transport regulator 2
2. Na(+)/K(+) ATPase subunit gamma
3. Sodium pump gamma chain

• 3-Methylthiofentanyl Action Pathway
• Acebutolol Action Pathway
• Alfentanil Action Pathway
• Alprenolol Action Pathway
• Alvimopan Action Pathway
• Amiloride Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Anileridine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Bendroflumethiazide Action Pathway
• Benzocaine Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Blue diaper syndrome
• Bopindolol Action Pathway
• Bumetanide Action Pathway
• Bupivacaine Action Pathway
• Bupranolol Action Pathway
• Buprenorphine Action Pathway
• Carfentanil Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Chloroprocaine Action Pathway
• Chlorothiazide Action Pathway
• Chlorthalidone Action Pathway
• Citalopram Action Pathway
• Cocaine Action Pathway
• Codeine Action Pathway
• Cyclothiazide Action Pathway
• Cystinuria
• Desipramine Action Pathway
• Dezocine Action Pathway
• Dibucaine Action Pathway
• Dihydromorphine Action Pathway
• Diltiazem Action Pathway
• Dimethylthiambutene Action Pathway
• Diphenoxylate Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Eplerenone Action Pathway
• Escitalopram Action Pathway
• Esmolol Action Pathway
• Ethacrynic Acid Action Pathway
• Ethylmorphine Action Pathway
• Felodipine Action Pathway
• Fentanyl Action Pathway
• Flecainide Action Pathway
• Fluoxetine Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Furosemide Action Pathway
• Glucose Transporter Defect (SGLT2)
• Hartnup Disorder
• Heroin Action Pathway
• Hydrochlorothiazide Action Pathway
• Hydrocodone Action Pathway
• Hydroflumethiazide Action Pathway
• Hydromorphone Action Pathway
• Ibutilide Action Pathway
• Iminoglycinuria
• Imipramine Action Pathway
• Indapamide Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Ketobemidone Action Pathway
• Kidney Function
• Labetalol Action Pathway
• Lactose Degradation
• Lactose Intolerance
• Levallorphan Action Pathway
• Levobunolol Action Pathway
• Levobupivacaine Action Pathway
• Levomethadyl Acetate Action Action Pathway
• Levorphanol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Lidocaine (Local Anaesthetic) Action Pathway
• Lysinuric Protein Intolerance
• Lysinuric protein intolerance (LPI)
• Mepivacaine Action Pathway
• Methadone Action Pathway
• Methadyl Acetate Action Pathway
• Methyclothiazide Action Pathway
• Metipranolol Action Pathway
• Metolazone Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Morphine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nalbuphine Action Pathway
• Naloxone Action Pathway
• Naltrexone Action Pathway
• Nebivolol Action Pathway
• Nicotine Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Oxybuprocaine Action Pathway
• Oxycodone Action Pathway
• Oxymorphone Action Pathway
• Penbutolol Action Pathway
• Pentazocine Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Polythiazide Action Pathway
• Practolol Action Pathway
• Prilocaine Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Procaine Action Pathway
• Proparacaine Action Pathway
• Propoxyphene Action Pathway
• Propranolol Action Pathway
• Quinethazone Action Pathway
• Quinidine Action Pathway
• Remifentanil Action Pathway
• Ropivacaine Action Pathway
• Sotalol Action Pathway
• Spironolactone Action Pathway
• Sufentanil Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Torsemide Action Pathway
• Tramadol Action Action Pathway
• Trehalose Degradation
• Triamterene Action Pathway
• Trichlormethiazide Action Pathway
• Verapamil Action Pathway

1. Membrane
2. Single-pass type III membrane protein (Potential)

>201 bp
ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTAC
TATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTG
GGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAA
ATCAATGAAGATGAGCCGTAA

• ATP1G1_PLM_MAT8 (PF02038 )

• None

• 29-46

>Sodium/potassium-transporting ATPase subunit gamma
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
2. Kim JW, Lee Y, Lee IA, Kang HB, Choe YK, Choe IS: Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit. Biochim Biophys Acta. 1997 Feb 7;1350(2):133-5. [PubMed:9048881 ]
3. Sweadner KJ, Wetzel RK, Arystarkhova E: Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase. Biochem Biophys Res Commun. 2000 Dec 9;279(1):196-201. [PubMed:11112438 ]
4. Meij IC, Koenderink JB, van Bokhoven H, Assink KF, Groenestege WT, de Pont JJ, Bindels RJ, Monnens LA, van den Heuvel LP, Knoers NV: Dominant isolated renal magnesium loss is caused by misrouting of the Na(+),K(+)-ATPase gamma-subunit. Nat Genet. 2000 Nov;26(3):265-6. [PubMed:11062458 ]