You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07474
Secondary Accession Numbers
  • 13182
Name Bombesin receptor subtype-3
Synonyms
  1. BRS-3
Gene Name BRS3
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
bombesin receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs BRS3
Gene Sequence
>1200 bp
ATGGCTCAAAGGCAGCCTCACTCACCTAATCAGACTTTAATTTCAATCACAAATGACACA
GAATCATCAAGCTCTGTGGTTTCTAACGATAACACAAATAAAGGATGGAGCGGGGACAAC
TCTCCAGGAATAGAAGCATTGTGTGCCATCTATATTACTTATGCTGTGATCATTTCAGTG
GGCATCCTTGGAAATGCTATTCTCATCAAAGTCTTTTTCAAGACCAAATCCATGCAAACA
GTTCCAAATATTTTCATCACCAGCCTGGCTTTTGGAGATCTTTTACTTCTGCTAACTTGT
GTGCCAGTGGATGCAACTCACTACCTTGCAGAAGGATGGCTGTTCGGAAGAATTGGTTGT
AAGGTGCTCTCTTTCATCCGGCTCACTTCTGTTGGTGTGTCAGTGTTCACATTAACAATT
CTCAGCGCTGACAGATACAAGGCAGTTGTGAAGCCACTTGAGCGACAGCCCTCCAATGCC
ATCCTGAAGACTTGTGTAAAAGCTGGCTGCGTCTGGATCGTGTCTATGATATTTGCTCTA
CCTGAGGCTATATTTTCAAATGTATACACTTTTCGAGATCCCAATAAAAATATGACATTT
GAATCATGTACCTCTTATCCTGTCTCTAAGAAGCTCTTGCAAGAAATACATTCTCTGCTG
TGCTTCTTAGTGTTCTACATTATTCCACTCTCTATTATCTCTGTCTACTATTCCTTGATT
GCTAGGACCCTTTACAAAAGCACCCTGAACATACCTACTGAGGAACAAAGCCATGCCCGT
AAGCAGATTGAATCCCGAAAGAGAATTGCCAGAACGGTATTGGTGTTGGTGGCTCTGTTT
GCCCTCTGCTGGTTGCCAAATCACCTCCTGTACCTCTACCATTCATTCACTTCTCAAACC
TATGTAGACCCCTCTGCCATGCATTTCATTTTCACCATTTTCTCTCGGGTTTTGGCTTTC
AGCAATTCTTGCGTAAACCCCTTTGCTCTCTACTGGCTGAGCAAAAGCTTCCAGAAGCAT
TTTAAAGCTCAGTTGTTCTGTTGCAAGGCGGAGCGGCCTGAGCCTCCTGTTGCTGACACC
TCTCTTACCACCCTGGCTGTGATGGGAACGGTCCCGGGCACTGGGAGCATACAGATGTCT
GAAATTAGTGTGACCTCGTTCACTGGGTGTAGTGTGAAGCAGGCAGAGGACAGATTCTAG
Protein Properties
Number of Residues 399
Molecular Weight 44410.4
Theoretical pI 8.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 42-63
  • 83-103
  • 122-143
  • 164-184
  • 221-241
  • 273-293
  • 314-333
Protein Sequence
>Bombesin receptor subtype-3
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
GenBank ID Protein 50612574
UniProtKB/Swiss-Prot ID P32247
UniProtKB/Swiss-Prot Entry Name BRS3_HUMAN
PDB IDs Not Available
GenBank Gene ID AY585193
GeneCard ID BRS3
GenAtlas ID BRS3
HGNC ID HGNC:1113
References
General References
  1. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  2. Fathi Z, Corjay MH, Shapira H, Wada E, Benya R, Jensen R, Viallet J, Sausville EA, Battey JF: BRS-3: a novel bombesin receptor subtype selectively expressed in testis and lung carcinoma cells. J Biol Chem. 1993 Mar 15;268(8):5979-84. [PubMed:8383682 ]
  3. Gorbulev V, Akhundova A, Grzeschik KH, Fahrenholz F: Organization and chromosomal localization of the gene for the human bombesin receptor subtype expressed in pregnant uterus. FEBS Lett. 1994 Mar 7;340(3):260-4. [PubMed:8131855 ]