You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07495
Secondary Accession Numbers
  • 13203
Name Voltage-dependent T-type calcium channel subunit alpha-1G
Synonyms
  1. Cav3.1c
  2. NBR13
  3. Voltage-gated calcium channel subunit alpha Cav3.1
Gene Name CACNA1G
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1G gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channels is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
calcium channel complex
voltage-gated calcium channel complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q22
SNPs CACNA1G
Gene Sequence
>7134 bp
ATGGACGAGGAGGAGGATGGAGCGGGCGCCGAGGAGTCGGGACAGCCCCGGAGCTTCATG
CGGCTCAACGACCTGTCGGGGGCCGGGGGCCGGCCGGGGCCGGGGTCAGCAGAAAAGGAC
CCGGGCAGCGCGGACTCCGAGGCGGAGGGGCTGCCGTACCCGGCGCTGGCCCCGGTGGTT
TTCTTCTACTTGAGCCAGGACAGCCGCCCGCGGAGCTGGTGTCTCCGCACGGTCTGTAAC
CCCTGGTTTGAGCGCATCAGCATGTTGGTCATCCTTCTCAACTGCGTGACCCTGGGCATG
TTCCGGCCATGCGAGGACATCGCCTGTGACTCCCAGCGCTGCCGGATCCTGCAGGCCTTT
GATGACTTCATCTTTGCCTTCTTTGCCGTGGAGATGGTGGTGAAGATGGTGGCCTTGGGC
ATCTTTGGGAAAAAGTGTTACCTGGGAGACACTTGGAACCGGCTTGACTTTTTCATCGTC
ATCGCAGGGATGCTGGAGTACTCGCTGGACCTGCAGAACGTCAGCTTCTCAGCTGTCAGG
ACAGTCCGTGTGCTGCGACCGCTCAGGGCCATTAACCGGGTGCCCAGCATGCGCATCCTT
GTCACGTTGCTGCTGGATACGCTGCCCATGCTGGGCAACGTCCTGCTGCTCTGCTTCTTC
GTCTTCTTCATCTTCGGCATCGTCGGCGTCCAGCTGTGGGCAGGGCTGCTTCGGAACCGA
TGCTTCCTACCTGAGAATTTCAGCCTCCCCCTGAGCGTGGACCTGGAGCGCTATTACCAG
ACAGAGAACGAGGATGAGAGCCCCTTCATCTGCTCCCAGCCACGCGAGAACGGCATGCGG
TCCTGCAGAAGCGTGCCCACGCTGCGCGGGGACGGGGGCGGTGGCCCACCTTGCGGTCTG
GACTATGAGGCCTACAACAGCTCCAGCAACACCACCTGTGTCAACTGGAACCAGTACTAC
ACCAACTGCTCAGCGGGGGAGCACAACCCCTTCAAGGGCGCCATCAACTTTGACAACATT
GGCTATGCCTGGATCGCCATCTTCCAGGTCATCACGCTGGAGGGCTGGGTCGACATCATG
TACTTTGTGATGGATGCTCATTCCTTCTACAATTTCATCTACTTCATCCTCCTCATCATC
GTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACGCAGTTCTCAGAG
ACCAAGCAGCGGGAAAGCCAGCTGATGCGGGAGCAGCGTGTGCGGTTCCTGTCCAACGCC
AGCACCCTGGCTAGCTTCTCTGAGCCCGGCAGCTGCTATGAGGAGCTGCTCAAGTACCTG
GTGTACATCCTTCGTAAGGCAGCCCGCAGGCTGGCTCAGGTCTCTCGGGCAGCAGGTGTG
CGGGTTGGGCTGCTCAGCAGCCCAGCACCCCTCGGGGGCCAGGAGACCCAGCCCAGCAGC
AGCTGCTCTCGCTCCCACCGCCGCCTATCCGTCCACCACCTGGTGCACCACCACCACCAC
CATCACCACCACTACCACCTGGGCAATGGGACGCTCAGGGCCCCCCGGGCCAGCCCGGAG
ATCCAGGACAGGGATGCCAATGGGTCCCGCAGGCTCATGCTGCCACCACCCTCGACGCCT
GCCCTCTCCGGGGCCCCCCCTGGTGGCGCAGAGTCTGTGCACAGCTTCTACCATGCCGAC
TGCCACTTAGAGCCAGTCCGCTGCCAGGCGCCCCCTCCCAGGTCCCCATCTGAGGCATCC
GGCAGGACTGTGGGCAGCGGGAAGGTGTATCCCACCGTGCACACCAGCCCTCCACCGGAG
ACGCTGAAGGAGAAGGCACTAGTAGAGGTGGCTGCCAGCTCTGGGCCCCCAACCCTCACC
AGCCTCAACATCCCACCCGGGCCCTACAGCTCCATGCACAAGCTGCTGGAGACACAGAGT
ACAGGTGCCTGCCAAAGCTCTTGCAAGATCTCCAGCCCTTGCTTGAAAGCAGACAGTGGA
GCCTGTGGTCCAGACAGCTGCCCCTACTGTGCCCGGGCCGGGGCAGGGGAGGTGGAGCTC
GCCGACCGTGAAATGCCTGACTCAGACAGCGAGGCAGTTTATGAGTTCACACAGGATGCC
CAGCACAGCGACCTCCGGGACCCCCACAGCCGGCGGCAACGGAGCCTGGGCCCAGATGCA
GAGCCCAGCTCTGTGCTGGCCTTCTGGAGGCTAATCTGTGACACCTTCCGAAAGATTGTG
GACAGCAAGTACTTTGGCCGGGGAATCATGATCGCCATCCTGGTCAACACACTCAGCATG
GGCATCGAATACCACGAGCAGCCCGAGGAGCTTACCAACGCCCTAGAAATCAGCAACATC
GTCTTCACCAGCCTCTTTGCCCTGGAGATGCTGCTGAAGCTGCTTGTGTATGGTCCCTTT
GGCTACATCAAGAATCCCTACAACATCTTCGATGGTGTCATTGTGGTCATCAGCGTGTGG
GAGATCGTGGGCCAGCAGGGGGGCGGCCTGTCGGTGCTGCGGACCTTCCGCCTGATGCGT
GTGCTGAAGCTGGTGCGCTTCCTGCCGGCGCTGCAGCGGCAGCTGGTGGTGCTCATGAAG
ACCATGGACAACGTGGCCACCTTCTGCATGCTGCTTATGCTCTTCATCTTCATCTTCAGC
ATCCTGGGCATGCATCTCTTCGGCTGCAAGTTTGCCTCTGAGCGGGATGGGGACACCCTG
CCAGACCGGAAGAATTTTGACTCCTTGCTCTGGGCCATCGTCACTGTCTTTCAGATCCTG
ACCCAGGAGGACTGGAACAAAGTCCTCTACAATGGTATGGCCTCCACGTCGTCCTGGGCG
GCCCTTTATTTCATTGCCCTCATGACCTTCGGCAACTACGTGCTCTTCAATTTGCTGGTC
GCCATTCTGGTGGAGGGCTTCCAGGCGGAGGAAATCAGCAAACGGGAAGATGCGAGTGGA
CAGTTAAGCTGTATTCAGCTGCCTGTCGACTCCCAGGGGGGAGATGCCAACAAGTCCGAA
TCAGAGCCCGATTTCTTCTCACCCAGCCTGGATGGTGATGGGGACAGGAAGAAGTGCTTG
GCCTTGGTGTCCCTGGGAGAGCACCCGGAGCTGCGGAAGAGCCTGCTGCCGCCTCTCATC
ATCCACACGGCCGCCACACCCATGTCGCTGCCCAAGAGCACCAGCACGGGCCTGGGCGAG
GCGCTGGGCCCTGCGTCGCGCCGCACCAGCAGCAGCGGGTCGGCAGAGCCTGGGGCGGCC
CACGAGATGAAGTCACCGCCCAGCGCCCGCAGCTCTCCGCACAGCCCCTGGAGCGCTGCA
AGCAGCTGGACCAGCAGGCGCTCCAGCCGGAACAGCCTCGGCCGTGCACCCAGCCTGAAG
CGGAGAAGCCCAAGTGGAGAGCGGCGGTCCCTGTTGTCGGGAGAAGGCCAGGAGAGCCAG
GATGAAGAGGAGAGCTCAGAAGAGGAGCGGGCCAGCCCTGCGGGCAGTGACCATCGCCAC
AGGGGGTCCCTGGAGCGGGAGGCCAAGAGTTCCTTTGACCTGCCAGACACACTGCAGGTG
CCAGGGCTGCATCGCACTGCCAGTGGCCGAGGGTCTGCTTCTGAGCACCAGGACTGCAAT
GGCAAGTCGGCTTCAGGGCGCCTGGCCCGGGCCCTGCGGCCTGATGACCCCCCACTGGAT
GGGGATGACGCCGATGACGAGGGCAACCTGAGCAAAGGGGAACGGGTCCGCGCGTGGATC
CGAGCCCGACTCCCTGCCTGCTGCCTCGAGCGAGACTCCTGGTCAGCCTACATCTTCCCT
CCTCAGTCCAGGTTCCGCCTCCTGTGTCACCGGATCATCACCCACAAGATGTTCGACCAC
GTGGTCCTTGTCATCATCTTCCTTAACTGCATCACCATCGCCATGGAGCGCCCCAAAATT
GACCCCCACAGCGCTGAACGCATCTTCCTGACCCTCTCCAATTACATCTTCACCGCAGTC
TTTCTGGCTGAAATGACAGTGAAGGTGGTGGCACTGGGCTGGTGCTTCGGGGAGCAGGCG
TACCTGCGGAGCAGTTGGAACGTGCTGGACGGGCTGTTGGTGCTCATCTCCGTCATCGAC
ATTCTGGTGTCCATGGTCTCTGACAGCGGCACCAAGATCCTGGGCATGCTGAGGGTGCTG
CGGCTGCTGCGGACCCTGCGCCCGCTCAGGGTGATCAGCCGGGCGCAGGGGCTGAAGCTG
GTGGTGGAGACGCTGATGTCCTCACTGAAACCCATCGGCAACATTGTAGTCATCTGCTGT
GCCTTCTTCATCATTTTCGGCATCTTGGGGGTGCAGCTCTTCAAAGGGAAGTTTTTCGTG
TGCCAGGGCGAGGATACCAGGAACATCACCAATAAATCGGACTGTGCCGAGGCCAGTTAC
CGGTGGGTCCGGCACAAGTACAACTTTGACAACCTTGGCCAGGCCCTGATGTCCCTGTTC
GTTTTGGCCTCCAAGGATGGTTGGGTGGACATCATGTACGATGGGCTGGATGCTGTGGGC
GTGGACCAGCAGCCCATCATGAACCACAACCCCTGGATGCTGCTGTACTTCATCTCGTTC
CTGCTCATTGTGGCCTTCTTTGTCCTGAACATGTTTGTGGGTGTGGTGGTGGAGAACTTC
CACAAGTGTCGGCAGCACCAGGAGGAAGAGGAGGCCCGGCGGCGGGAGGAGAAGCGCCTA
CGAAGACTGGAGAAAAAGAGAAGGAATCTAATGCTGGACGATGTAATTGCTTCCGGCAGC
TCAGCCAGCGCTGCGTCAGAAGCCCAGTGCAAACCTTACTACTCCGACTACTCCCGCTTC
CGGCTCCTCGTCCACCACTTGTGCACCAGCCACTACCTGGACCTCTTCATCACAGGTGTC
ATCGGGCTGAACGTGGTCACCATGGCCATGGAGCACTACCAGCAGCCCCAGATTCTGGAT
GAGGCTCTGAAGATCTGCAACTACATCTTCACTGTCATCTTTGTCTTGGAGTCAGTTTTC
AAACTTGTGGCCTTTGGTTTCCGTCGGTTCTTCCAGGACAGGTGGAACCAGCTGGACCTG
GCCATTGTGCTGCTGTCCATCATGGGCATCACGCTGGAGGAAATCGAGGTCAACGCCTCG
CTGCCCATCAACCCCACCATCATCCGCATCATGAGGGTGCTGCGCATTGCCCGAGTGCTG
AAGCTGCTGAAGATGGCTGTGGGCATGCGGGCGCTGCTGGACACGGTGATGCAGGCCCTG
CCCCAGGTGGGGAACCTGGGACTTCTCTTCATGTTGTTGTTTTTCATCTTTGCAGCTCTG
GGCGTGGAGCTCTTTGGAGACCTGGAGTGTGACGAGACACACCCCTGTGAGGGCCTGGGC
CGTCATGCCACCTTTCGGAACTTTGGCATGGCCTTCCTAACCCTCTTCCGAGTCTCCACA
GGTGACAATTGGAATGGCATTATGAAGGACACCCTCCGGGACTGTGACCAGGAGTCCACC
TGCTACAACACGGTCATCTCGCCTATCTACTTTGTGTCCTTCGTGCTGACGGCCCAGTTC
GTGCTAGTCAACGTGGTGATCGCCGTGCTGATGAAGCACCTGGAGGAGAGCAACAAGGAG
GCCAAGGAGGAGGCCGAGCTAGAGGCTGAGCTGGAGCTGGAGATGAAGACCCTCAGCCCC
CAGCCCCACTCGCCACTGGGCAGCCCCTTCCTCTGGCCTGGGGTCGAGGGCCCCGACAGC
CCCGACAGCCCCAAGCCTGGGGCTCTGCACCCAGCGGCCCACGCGAGATCAGCCTCCCAC
TTTTCCCTGGAGCACCCCACGGACAGGCAGCTGTTTGACACCATATCCCTGCTGATCCAG
GGCTCCCTGGAGTGGGAGCTGAAGCTGATGGACGAGCTGGCAGGCCCAGGGGGCCAGCCC
TCTGCCTTCCCTTCTGCCCCCAGCCTGGGAGGCTCCGACCCACAGATCCCTCTAGCTGAG
ATGGAGGCTCTGTCTCTGACGTCAGAGATTGTGTCTGAACCGTCCTGCTCTCTAGCTCTG
ACGGATGACTCTTTGCCTGATGACATGCACACACTCTTACTTAGTGCCCTGGAGAGCAAT
ATGCAGCCCCACCCCACGGAGCTGCCAGGACCAGACTTACTGACTGTGCGGAAGTCTGGG
GTCAGCCGAACGCACTCTCTGCCCAATGACAGCTACATGTGTCGGCATGGGAGCACTGCC
GAGGGGCCCCTGGGACACAGGGGCTGGGGGCTCCCCAAAGCTCAGTCAGGCTCCGTCTTG
TCCGTTCACTCCCAGCCAGCAGATACCAGCTACATCCTGCAGCTTCCCAAAGATGCACCT
CATCTGCTCCAGCCCCACAGCGCCCCAACCTGGGGCACCATCCCCAAACTGCCCCCACCA
GGACGCTCCCCTTTGGCTCAGAGGCCACTCAGGCGCCAGGCAGCAATAAGGACTGACTCC
TTGGACGTTCAGGGTCTGGGCAGCCGGGAAGACCTGCTGGCAGAGGTGAGTGGGCCCTCC
CCGCCCCTGGCCCGGGCCTACTCTTTCTGGGGCCAGTCAAGTACCCAGGCACAGCAGCAC
TCCCGCAGCCACAGCAAGATCTCCAAGCACATGACCCCGCCAGCCCCTTGCCCAGGCCCA
GAACCCAACTGGGGCAAGGGCCCTCCAGAGACCAGAAGCAGCTTAGAGTTGGACACGGAG
CTGAGCTGGATTTCAGGAGACCTCCTGCCCCCTGGCGGCCAGGAGGAGCCCCCATCCCCA
CGGGACCTGAAGAAGTGCTACAGCGTGGAGGCCCAGAGCTGCCAGCGCCGGCCTACGTCC
TGGCTGGATGAGCAGAGGAGACACTCTATCGCCGTCAGCTGCCTGGACAGCGGCTCCCAA
CCCCACCTGGGCACAGACCCCTCTAACCTTGGGGGCCAGCCTCTTGGGGGGCCTGGGAGC
CGGCCCAAGAAAAAACTCAGCCCGCCTAGTATCACCATAGACCCCCCCGAGAGCCAAGGT
CCTCGGACCCCGCCCAGCCCTGGTATCTGCCTCCGGAGGAGGGCTCCGTCCAGCGACTCC
AAGGATCCCTTGGCCTCTGGCCCCCCTGACAGCATGGCTGCCTCGCCCTCCCCAAAGAAA
GATGTGCTGAGTCTCTCCGGTTTATCCTCTGACCCAGCAGACCTGGACCCCTGA
Protein Properties
Number of Residues 2377
Molecular Weight 262468.6
Theoretical pI 6.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 81-101
  • 120-141
  • 151-170
  • 176-193
  • 214-234
  • 371-395
  • 744-764
  • 778-799
  • 806-824
  • 833-856
  • 868-888
  • 940-964
  • 1273-1295
  • 1314-1334
  • 1345-1364
  • 1379-1400
  • 1411-1434
  • 1512-1537
  • 1611-1631
  • 1646-1667
  • 1675-1693
  • 1708-1731
  • 1746-1766
  • 1827-1854
Protein Sequence
>Voltage-dependent T-type calcium channel subunit alpha-1G
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE
MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG
VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS
PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE
LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ
PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS
KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
GenBank ID Protein 6625659
UniProtKB/Swiss-Prot ID O43497
UniProtKB/Swiss-Prot Entry Name CAC1G_HUMAN
PDB IDs Not Available
GenBank Gene ID AF134986
GeneCard ID CACNA1G
GenAtlas ID CACNA1G
HGNC ID HGNC:1394
References
General References
  1. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  2. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  3. Mittman S, Guo J, Agnew WS: Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit. Neurosci Lett. 1999 Oct 29;274(3):143-6. [PubMed:10548410 ]
  4. Cribbs LL, Gomora JC, Daud AN, Lee JH, Perez-Reyes E: Molecular cloning and functional expression of Ca(v)3.1c, a T-type calcium channel from human brain. FEBS Lett. 2000 Jan 21;466(1):54-8. [PubMed:10648811 ]
  5. Monteil A, Chemin J, Bourinet E, Mennessier G, Lory P, Nargeot J: Molecular and functional properties of the human alpha(1G) subunit that forms T-type calcium channels. J Biol Chem. 2000 Mar 3;275(9):6090-100. [PubMed:10692398 ]
  6. Toyota M, Ho C, Ohe-Toyota M, Baylin SB, Issa JP: Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors. Cancer Res. 1999 Sep 15;59(18):4535-41. [PubMed:10493502 ]
  7. Perez-Reyes E, Cribbs LL, Daud A, Lacerda AE, Barclay J, Williamson MP, Fox M, Rees M, Lee JH: Molecular characterization of a neuronal low-voltage-activated T-type calcium channel. Nature. 1998 Feb 26;391(6670):896-900. [PubMed:9495342 ]