You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07499
Secondary Accession Numbers
  • 13207
Name Voltage-dependent L-type calcium channel subunit beta-1
Synonyms
  1. CAB1
  2. Calcium channel voltage-dependent subunit beta 1
Gene Name CACNB1
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated calcium channel activity
Specific Function The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting
Pathways
  • 3-Methylthiofentanyl Action Pathway
  • Acebutolol Action Pathway
  • Alfentanil Action Pathway
  • Alprenolol Action Pathway
  • Alvimopan Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Anileridine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Benzocaine Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupivacaine Action Pathway
  • Bupranolol Action Pathway
  • Buprenorphine Action Pathway
  • Carfentanil Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Chloroprocaine Action Pathway
  • Citalopram Action Pathway
  • Cocaine Action Pathway
  • Codeine Action Pathway
  • Desipramine Action Pathway
  • Dezocine Action Pathway
  • Dibucaine Action Pathway
  • Dihydromorphine Action Pathway
  • Diltiazem Action Pathway
  • Dimethylthiambutene Action Pathway
  • Diphenoxylate Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Escitalopram Action Pathway
  • Esmolol Action Pathway
  • Ethylmorphine Action Pathway
  • Felodipine Action Pathway
  • Felodipine Metabolism Pathway
  • Fentanyl Action Pathway
  • Flecainide Action Pathway
  • Fluoxetine Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Glibenclamide Action Pathway
  • Gliclazide Action Pathway
  • Heroin Action Pathway
  • Hydrocodone Action Pathway
  • Hydromorphone Action Pathway
  • Ibutilide Action Pathway
  • Imipramine Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Ketobemidone Action Pathway
  • Labetalol Action Pathway
  • Levallorphan Action Pathway
  • Levobunolol Action Pathway
  • Levobupivacaine Action Pathway
  • Levomethadyl Acetate Action Action Pathway
  • Levorphanol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Lidocaine (Local Anaesthetic) Action Pathway
  • Mepivacaine Action Pathway
  • Methadone Action Pathway
  • Methadyl Acetate Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Morphine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nalbuphine Action Pathway
  • Naloxone Action Pathway
  • Naltrexone Action Pathway
  • Nateglinide Action Pathway
  • Nebivolol Action Pathway
  • Nicotine Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Oxybuprocaine Action Pathway
  • Oxycodone Action Pathway
  • Oxymorphone Action Pathway
  • Pancreas Function
  • Penbutolol Action Pathway
  • Pentazocine Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Prilocaine Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Procaine Action Pathway
  • Proparacaine Action Pathway
  • Propoxyphene Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Remifentanil Action Pathway
  • Repaglinide Action Pathway
  • Ropivacaine Action Pathway
  • Sotalol Action Pathway
  • Sufentanil Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Tramadol Action Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. sarcolemma
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21-q22
SNPs CACNB1
Gene Sequence
>1797 bp
ATGGTCCAGAAGACCAGCATGTCCCGGGGCCCTTACCCACCCTCCCAGGAGATCCCCATG
GAGGTCTTCGACCCCAGCCCGCAGGGCAAATACAGCAAGAGGAAAGGGCGATTCAAACGG
TCAGATGGGAGCACGTCCTCGGATACCACATCCAACAGCTTTGTCCGCCAGGGCTCAGCG
GAGTCCTACACCAGCCGTCCATCAGACTCTGATGTATCTCTGGAGGAGGACCGGGAAGCC
TTAAGGAAGGAAGCAGAGCGCCAGGCATTAGCGCAGCTCGAGAAGGCCAAGACCAAGCCA
GTGGCATTTGCTGTGCGGACAAATGTTGGCTACAATCCGTCTCCAGGGGATGAGGTGCCT
GTGCAGGGAGTGGCCATCACCTTCGAGCCCAAAGACTTCCTGCACATCAAGGAGAAATAC
AATAATGACTGGTGGATCGGGCGGCTGGTGAAGGAGGGCTGTGAGGTTGGCTTCATTCCC
AGCCCCGTCAAACTGGACAGCCTTCGCCTGCTGCAGGAACAGAAGCTGCGCCAGAACCGC
CTCGGCTCCAGCAAATCAGGCGATAACTCCAGTTCCAGTCTGGGAGATGTGGTGACTGGC
ACCCGCCGCCCCACACCCCCTGCCAGTGCCAAACAGAAGCAGAAGTCGACAGAGCATGTG
CCCCCCTATGACGTGGTGCCTTCCATGAGGCCCATCATCCTGGTGGGACCGTCGCTCAAG
GGCTACGAGGTTACAGACATGATGCAGAAAGCTTTATTTGACTTCTTGAAGCATCGGTTT
GATGGCAGGATCTCCATCACTCGTGTGACGGCAGATATTTCCCTGGCTAAGCGCTCAGTT
CTCAACAACCCCAGCAAACACATCATCATTGAGCGCTCCAACACACGCTCCAGCCTGGCT
GAGGTGCAGAGTGAAATCGAGCGAATCTTCGAGCTGGCCCGGACCCTTCAGTTGGTCGCT
CTGGATGCTGACACCATCAATCACCCAGCCCAGCTGTCCAAGACCTCGCTGGCCCCCATC
ATTGTTTACATCAAGATCACCTCTCCCAAGGTACTTCAAAGGCTCATCAAGTCCCGAGGA
AAGTCTCAGTCCAAACACCTCAATGTCCAAATAGCGGCCTCGGAAAAGCTGGCACAGTGC
CCCCCTGAAATGTTTGACATCATCCTGGATGAGAACCAATTGGAGGATGCCTGCGAGCAT
CTGGCGGAGTACTTGGAAGCCTATTGGAAGGCCACACACCCGCCCAGCAGCACGCCACCC
AATCCGCTGCTGAACCGCACCATGGCTACCGCAGCCCTGGCTGCCAGCCCTGCCCCTGTC
TCCAACCTCCAGGGACCCTACCTTGCTTCCGGGGACCAGCCACTGGAACGGGCCACCGGG
GAGCACGCCAGCATGCACGAGTACCCAGGGGAGCTGGGCCAGCCCCCAGGCCTTTACCCC
AGCAGCCACCCACCAGGCCGGGCAGGCACGCTACGGGCACTGTCCCGCCAAGACACTTTT
GATGCCGACACCCCCGGCAGCCGAAACTCTGCCTACACGGAGCTGGGAGACTCATGTGTG
GACATGGAGACTGACCCCTCAGAGGGGCCAGGGCTTGGAGACCCTGCAGGGGGCGGCACG
CCCCCAGCCCGACAGGGATCCTGGGAGGACGAGGAAGAAGACTATGAGGAAGAGCTGACC
GACAACCGGAACCGGGGCCGGAATAAGGCCCGCTACTGCGCTGAGGGTGGGGGTCCAGTT
TTGGGGCGCAACAAGAATGAGCTGGAGGGCTGGGGACGAGGCGTCTACATTCGCTGA
Protein Properties
Number of Residues 598
Molecular Weight 65713.0
Theoretical pI 6.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Voltage-dependent L-type calcium channel subunit beta-1
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
GenBank ID Protein 12483680
UniProtKB/Swiss-Prot ID Q02641
UniProtKB/Swiss-Prot Entry Name CACB1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB054985
GeneCard ID CACNB1
GenAtlas ID CACNB1
HGNC ID HGNC:1401
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Williams ME, Feldman DH, McCue AF, Brenner R, Velicelebi G, Ellis SB, Harpold MM: Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype. Neuron. 1992 Jan;8(1):71-84. [PubMed:1309651 ]
  6. Brust PF, Simerson S, McCue AF, Deal CR, Schoonmaker S, Williams ME, Velicelebi G, Johnson EC, Harpold MM, Ellis SB: Human neuronal voltage-dependent calcium channels: studies on subunit structure and role in channel assembly. Neuropharmacology. 1993 Nov;32(11):1089-102. [PubMed:8107964 ]
  7. Powers PA, Liu S, Hogan K, Gregg RG: Skeletal muscle and brain isoforms of a beta-subunit of human voltage-dependent calcium channels are encoded by a single gene. J Biol Chem. 1992 Nov 15;267(32):22967-72. [PubMed:1385409 ]
  8. Collin T, Wang JJ, Nargeot J, Schwartz A: Molecular cloning of three isoforms of the L-type voltage-dependent calcium channel beta subunit from normal human heart. Circ Res. 1993 Jun;72(6):1337-44. [PubMed:7916667 ]
  9. Fukuda K, Kaneko S, Yada N, Kikuwaka M, Akaike A, Satoh M: Cyclic AMP-dependent modulation of N- and Q-type Ca2+ channels expressed in Xenopus oocytes. Neurosci Lett. 1996 Oct 11;217(1):13-6. [PubMed:8905728 ]
  10. Hogan K, Greg RG, Powers PA: Structure and alternative splicing of the gene encoding the human beta1 subunit of voltage dependent calcium channels. Neurosci Lett. 1999 Dec 24;277(2):111-4. [PubMed:10624822 ]
  11. Iles DE, Segers B, Sengers RC, Monsieurs K, Heytens L, Halsall PJ, Hopkins PM, Ellis FR, Hall-Curran JL, Stewart AD, et al.: Genetic mapping of the beta 1- and gamma-subunits of the human skeletal muscle L-type voltage-dependent calcium channel on chromosome 17q and exclusion as candidate genes for malignant hyperthermia susceptibility. Hum Mol Genet. 1993 Jul;2(7):863-8. [PubMed:8395940 ]