You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07500
Secondary Accession Numbers
  • 13208
Name Voltage-dependent L-type calcium channel subunit beta-2
Synonyms
  1. CAB2
  2. Calcium channel voltage-dependent subunit beta 2
  3. Lambert-Eaton myasthenic syndrome antigen B
  4. MYSB
Gene Name CACNB2
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated calcium channel activity
Specific Function The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting
Pathways Not Available
Reactions Not Available
GO Classification
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. sarcolemma
Gene Properties
Chromosome Location Chromosome:1
Locus 10p12
SNPs CACNB2
Gene Sequence
>1983 bp
ATGGTCCAAAGGGACATGTCCAAGTCGCCTCCCACAGCGGCGGCGGCGGTGGCGCAGGAG
ATCCAGATGGAACTGCTAGAGAACGTGGCTCCCGCGGGGGCGCTCGGAGCCGCCGCACAG
TCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCA
TCTGATACTACCTCAAATAGTTTTCTTCGCCAGGGTTCGGCAGACTCCTACACTAGCCGT
CCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGCAG
CAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACA
GATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCA
TTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGGATAGGG
CGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAAC
ATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTCTACTCCAGTAAATCAGGA
GGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACACCTCCA
TCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAAGAAAATGATATTCCAGCA
AACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCACCCCACTCCAAAGAGAAA
AGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTATGATGTGGTACCTTCCATG
CGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAA
AAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGGATATCCATCACAAGGGTC
ACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCACGCAATA
ATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATT
TTTGAAGTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCGGATACAATTAATCATCCA
GCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCTTCTCCT
AAGGTTTTACAAACCTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTC
CAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTG
GATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTACTGG
AAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCC
ACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTCAT
CAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACCTAGT
GTGGAAGGAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCAT
CGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAG
AGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGACCAC
TATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGA
CACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCAGGACCACAACGAGTGC
AACAAGCAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGAA
GTGATATCAAAAAAACGGAATGAGGCTGGGGAGTGGAACAGGGATGTTTACATCCGCCAA
TGA
Protein Properties
Number of Residues 660
Molecular Weight 73579.9
Theoretical pI 8.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Voltage-dependent L-type calcium channel subunit beta-2
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
GenBank ID Protein 4928801
UniProtKB/Swiss-Prot ID Q08289
UniProtKB/Swiss-Prot Entry Name CACB2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF137376
GeneCard ID CACNB2
GenAtlas ID CACNB2
HGNC ID HGNC:1402
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Antzelevitch C, Pollevick GD, Cordeiro JM, Casis O, Sanguinetti MC, Aizawa Y, Guerchicoff A, Pfeiffer R, Oliva A, Wollnik B, Gelber P, Bonaros EP Jr, Burashnikov E, Wu Y, Sargent JD, Schickel S, Oberheiden R, Bhatia A, Hsu LF, Haissaguerre M, Schimpf R, Borggrefe M, Wolpert C: Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death. Circulation. 2007 Jan 30;115(4):442-9. Epub 2007 Jan 15. [PubMed:17224476 ]
  5. Rosenfeld MR, Wong E, Dalmau J, Manley G, Posner JB, Sher E, Furneaux HM: Cloning and characterization of a Lambert-Eaton myasthenic syndrome antigen. Ann Neurol. 1993 Jan;33(1):113-20. [PubMed:8494331 ]
  6. Taviaux S, Williams ME, Harpold MM, Nargeot J, Lory P: Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23. Hum Genet. 1997 Aug;100(2):151-4. [PubMed:9254841 ]
  7. Yada H, Murata M, Shimoda K, Yuasa S, Kawaguchi H, Ieda M, Adachi T, Murata M, Ogawa S, Fukuda K: Dominant negative suppression of Rad leads to QT prolongation and causes ventricular arrhythmias via modulation of L-type Ca2+ channels in the heart. Circ Res. 2007 Jul 6;101(1):69-77. Epub 2007 May 24. [PubMed:17525370 ]