You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07501
Secondary Accession Numbers
  • 13209
Name Voltage-dependent L-type calcium channel subunit beta-3
Synonyms
  1. CAB3
  2. Calcium channel voltage-dependent subunit beta 3
Gene Name CACNB3
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated calcium channel activity
Specific Function The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting
Pathways Not Available
Reactions Not Available
GO Classification
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13
SNPs CACNB3
Gene Sequence
>1455 bp
ATGTATGACGACTCCTACGTGCCCGGGTTTGAGGACTCGGAGGCGGGTTCAGCCGACTCC
TACACCAGCCGCCCATCTCTGGACTCAGACGTCTCCCTGGAGGAGGACCGGGAGAGTGCC
CGGCGTGAAGTAGAGAGCCAGGCTCAGCAGCAGCTCGAAAGGGCCAAGCACAAACCTGTG
GCATTTGCGGTGAGGACCAATGTCAGCTACTGTGGCGTACTGGATGAGGAGTGCCCAGTC
CAGGGCTCTGGAGTCAACTTTGAGGCCAAAGATTTTCTGCACATTAAAGAGAAGTACAGC
AATGACTGGTGGATCGGGCGGCTAGTGAAAGAGGGCGGGGACATCGCCTTCATCCCCAGC
CCCCAGCGCCTGGAGAGCATCCGGCTCAAACAGGAGCAGAAGGCCAGGAGATCTGGGAAC
CCTTCCAGCCTGAGTGACATTGGCAACCGACGCTCCCCTCCGCCATCTCTAGCCAAGCAG
AAGCAAAAGCAGGCGGAACATGTTCCCCCATATGACGTGGTGCCCTCCATGCGGCCTGTG
GTGCTGGTGGGACCCTCTCTGAAAGGTTATGAGGTCACAGACATGATGCAGAAGGCTCTC
TTCGACTTCCTCAAACACAGATTTGATGGCAGGATCTCCATCACCCGAGTCACAGCCGAC
CTCTCCCTGGCAAAGCGATCTGTGCTCAACAATCCGGGCAAGAGGACCATCATTGAGCGC
TCCTCTGCCCGCTCCAGCATTGCGGAAGTGCAGAGTGAGATCGAGCGCATATTTGAGCTG
GCCAAATCCCTGCAGCTAGTAGTGTTGGACGCTGACACCATCAACCACCCAGCACAGCTG
GCCAAGACCTCGCTGGCCCCCATCATCGTCTTTGTCAAAGTGTCCTCACCAAAGGTACTC
CAGCGTCTCATTCGCTCCCGGGGGAAGTCACAGATGAAGCACCTGACCGTACAGATGATG
GCATATGATAAGCTGGTTCAGTGCCCACCGGAGTCATTTGATGTGATTCTGGATGAGAAC
CAGCTGGAGGATGCCTGTGAGCACCTGGCTGAGTACCTGGAGGTTTACTGGCGGGCCACG
CACCACCCAGCCCCTGGCCCCGGACTTCTGGGTCCTCCCAGTGCCATCCCCGGACTTCAG
AACCAGCAGCTGCTGGGGGAGCGTGGCGAGGAGCACTCCCCCCTTGAGCGGGACAGCTTG
ATGCCCTCTGATGAGGCCAGCGAGAGCTCCCGCCAAGCCTGGACAGGATCTTCACAGCGT
AGCTCCCGCCACCTGGAGGAGGACTATGCAGATGCCTACCAGGACCTGTACCAGCCTCAC
CGCCAACACACCTCGGGGCTGCCTAGTGCTAACGGGCATGACCCCCAAGACCGGCTTCTA
GCCCAGGACTCAGAGCACAACCACAGTGACCGGAACTGGCAGCGCAACCGGCCTTGGCCC
AAGGATAGCTACTGA
Protein Properties
Number of Residues 484
Molecular Weight 54531.4
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Voltage-dependent L-type calcium channel subunit beta-3
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
KDSY
GenBank ID Protein 435135
UniProtKB/Swiss-Prot ID P54284
UniProtKB/Swiss-Prot Entry Name CACB3_HUMAN
PDB IDs
GenBank Gene ID X76555
GeneCard ID CACNB3
GenAtlas ID CACNB3
HGNC ID HGNC:1403
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Yamada Y, Masuda K, Li Q, Ihara Y, Kubota A, Miura T, Nakamura K, Fujii Y, Seino S, Seino Y: The structures of the human calcium channel alpha 1 subunit (CACNL1A2) and beta subunit (CACNLB3) genes. Genomics. 1995 May 20;27(2):312-9. [PubMed:7557998 ]
  5. Qin N, Yagel S, Momplaisir ML, Codd EE, D'Andrea MR: Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit. Mol Pharmacol. 2002 Sep;62(3):485-96. [PubMed:12181424 ]
  6. Collin T, Lory P, Taviaux S, Courtieu C, Guilbault P, Berta P, Nargeot J: Cloning, chromosomal location and functional expression of the human voltage-dependent calcium-channel beta 3 subunit. Eur J Biochem. 1994 Feb 15;220(1):257-62. [PubMed:8119293 ]