You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07531
Secondary Accession Numbers
  • 13239
Name Calmodulin-like protein 5
Synonyms
  1. Calmodulin-like skin protein
Gene Name CALML5
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Binds calcium. May be involved in terminal differentiation of keratinocytes
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10p15.1
SNPs CALML5
Gene Sequence
>441 bp
ATGGCCGGTGAGCTGACTCCTGAGGAGGAGGCCCAGTACAAAAAGGCTTTCTCCGCGGTT
GACACGGATGGAAACGGCACCATCAATGCCCAGGAGCTGGGCGCGGCGCTGAAGGCCACG
GGCAAGAACCTCTCGGAGGCCCAGCTAAGGAAACTCATCTCCGAGGTTGACAGCGACGGC
GACGGCGAAATCAGCTTCCAGGAGTTCCTGACGGCGGCAAGGAAGGCCAGGGCCGGCCTG
GAGGACCTGCAGGTCGCCTTCCGCGCCTTCGACCAGGATGGCGACGGCCACATCACCGTG
GACGAGCTCAGGCGGGCCATGGCGGGGCTGGGGCAGCCGCTGCCGCAGGAGGAGCTGGAC
GCCATGATCCGCGAGGCCGACGTGGACCAGGACGGGCGGGTGAACTACGAGGAGTTCGCG
AGGATGCTCGCCCAGGAGTGA
Protein Properties
Number of Residues 146
Molecular Weight 15892.4
Theoretical pI 4.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calmodulin-like protein 5
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLAQE
GenBank ID Protein 7673316
UniProtKB/Swiss-Prot ID Q9NZT1
UniProtKB/Swiss-Prot Entry Name CALL5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF172852
GeneCard ID CALML5
GenAtlas ID CALML5
HGNC ID HGNC:18180
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Mehul B, Bernard D, Simonetti L, Bernard MA, Schmidt R: Identification and cloning of a new calmodulin-like protein from human epidermis. J Biol Chem. 2000 Apr 28;275(17):12841-7. [PubMed:10777582 ]
  4. Babini E, Bertini I, Capozzi F, Chirivino E, Luchinat C: A structural and dynamic characterization of the EF-hand protein CLSP. Structure. 2006 Jun;14(6):1029-38. [PubMed:16765896 ]