You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07541
Secondary Accession Numbers
  • 13249
Name Calpain-12
Synonyms
  1. CANP 12
  2. Calcium-activated neutral proteinase 12
Gene Name CAPN12
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Calcium-regulated non-lysosomal thiol-protease
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.2
SNPs CAPN12
Gene Sequence
>2160 bp
ATGGCATCCAGCAGTGGGAGGGTCACCATCCAGCTCGTGGATGAGGAGGCTGGGGTCGGA
GCCGGGCGCCTGCAGCTTTTTCGGGGCCAGAGCTATGAGGCAATTCGGGCAGCCTGCCTG
GATTCGGGGATCCTGTTCCGCGACCCTTACTTCCCTGCTGGCCCTGATGCCCTTGGCTAT
GACCAGCTGGGGCCGGACTCGGAGAAGGCCAAAGGCGTGAAATGGATGAGGCCCCATGAG
TTCTGTGCTGAGCCGAAGTTCATCTGTGAAGACATGAGCCGCACAGACGTGTGTCAGGGG
AGCCTGGGTAACTGCTGGTTCCTTGCAGCCGCCGCCTCCCTTACTCTGTATCCCCGGCTC
CTGCGCCGGGTGGTCCCTCCTGGACAGGATTTCCAGCATGGCTACGCAGGCGTCTTCCAC
TTCCAGCTCTGGCAGTTTGGCCGCTGGATGGACGTCGTGGTGGATGACAGGCTGCCCGTG
CGTGAGGGGAAGCTGATGTTCGTGCGCTCGGAACAGCGGAATGAGTTCTGGGCCCCACTC
CTGGAGAAGGCCTACGCCAAGCTCCACGGCTCCTATGAGGTGATGCGGGGCGGCCACATG
AATGAGGCTTTTGTGGATTTCACAGGCGGCGTGGGCGAGGTGCTCTATCTGAGACAAAAC
AGCATGGGGCTGTTCTCTGCCCTGCGCCATGCCCTGGCCAAGGAGTCCCTCGTGGGCGCC
ACTGCCCTGAGTGATCGGGGTGAGTACCGCACAGAAGAGGGCCTGGTAAAGGGACACGCG
TATTCCATCACGGGCACACACAAGGTGTTCCTGGGCTTCACCAAGGTGCGGCTGCTGCGG
CTGCGGAACCCATGGGGCTGCGTGGAGTGGACGGGGGCCTGGAGCGACAGCTGCCCACGC
TGGGACACACTCCCCACCGAGTGCCGCGATGCCCTGCTGGTGAAAAAGGAGGATGGCGAG
TTCTGGATGGAGCTGCGGGACTTCCTCCTCCATTTCGACACCGTGCAGATCTGCTCGCTG
AGCCCGGAGGTGCTGGGCCCCAGCCCGGAGGGGGGCGGCTGGCACGTCCACACCTTCCAA
GGCCGCTGGGTGCGTGGCTTCAACTCCGGCGGGAGCCAGCCTAATGCTGAAACCTTCTGG
ACCAATCCTCAGTTCCGTTTAACGCTGCTGGAGCCTGATGAGGAGGATGACGAGGATGAG
GAAGGGCCCTGGGGGGGCTGGGGGGCTGCAGGGGCACGGGGCCCAGCGCGGGGGGGCCGC
ACGCCCAAGTGCACGGTCCTTCTGTCCCTCATCCAGCGCAACCGGCGGCGCCTGAGAGCC
AAGGGCCTCACTTACCTCACCGTTGGCTTCCACGTGTTCCAGATTCCAGAGGAGCTGCTG
GGCCTCTGGGATTCCCCGCGCAGCCATGCGCTCCTGCCCCGGCTGCTGCGCGCCGACCGC
TCGCCCCTCAGCGCCCGCCGCGACGTGACCCGCCGCTGCTGCCTGCGTCCAGGCCACTAC
CTGGTGGTGCCGAGCACCGCCCACGCCGGCGACGAGGCTGACTTCACTCTGCGTGTCTTC
TCCGAGCGCCGCCACACGGCCGTGGAGATCGACGACGTGATCAGCGCAGACCTGCAGTCT
CTCCAGGGCCCCTACCTGCCCCTGGAGCTGGGGTTGGAGCAGCTGTTTCAGGAGCTGGCT
GGAGAGGAGGAAGAACTCAATGCCTCTCAGCTCCAGGCCTTACTAAGCATTGCCCTGGAG
CCTGCCAGGGCCCATACCTCCACCCCCAGAGAGATCGGGCTCAGGACCTGTGAGCAGCTG
CTGCAGTGTTTCGGGCATGGGCAAAGCCTGGCCTTACACCACTTCCAGCAGCTCTGGGGC
TACCTCCTGGAGTGGCAGGCCATATTCAACAAGTTCGATGAGGACACCTCTGGAACCATG
AACTCCTACGAGCTGAGGCTGGCACTGAATGCAGCAGGCTTCCACCTGAACAACCAGCTG
ACCCAGACCCTCACCAGCCGCTACCGGGATAGCCGTCTGCGTGTGGACTTCGAGCGGTTC
GTGTCCTGTGTGGCCCACCTCACCTGCATCTTCTGCCACTGCAGCCAGCACCTGGATGGG
GGTGAGGGGGTCATCTGCCTGACCCACAGACAGTGGATGGAGGTGGCCACCTTCTCCTAG
Protein Properties
Number of Residues 719
Molecular Weight 81036.2
Theoretical pI 6.34
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-12
MASSSGRVTIQLVDEEAGVGAGRLQLFRGQSYEAIRAACLDSGILFRDPYFPAGPDALGY
DQLGPDSEKAKGVKWMRPHEFCAEPKFICEDMSRTDVCQGSLGNCWFLAAAASLTLYPRL
LRRVVPPGQDFQHGYAGVFHFQLWQFGRWMDVVVDDRLPVREGKLMFVRSEQRNEFWAPL
LEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNSMGLFSALRHALAKESLVGA
TALSDRGEYRTEEGLVKGHAYSITGTHKVFLGFTKVRLLRLRNPWGCVEWTGAWSDSCPR
WDTLPTECRDALLVKKEDGEFWMELRDFLLHFDTVQICSLSPEVLGPSPEGGGWHVHTFQ
GRWVRGFNSGGSQPNAETFWTNPQFRLTLLEPDEEDDEDEEGPWGGWGAAGARGPARGGR
TPKCTVLLSLIQRNRRRLRAKGLTYLTVGFHVFQIPEELLGLWDSPRSHALLPRLLRADR
SPLSARRDVTRRCCLRPGHYLVVPSTAHAGDEADFTLRVFSERRHTAVEIDDVISADLQS
LQGPYLPLELGLEQLFQELAGEEEELNASQLQALLSIALEPARAHTSTPREIGLRTCEQL
LQCFGHGQSLALHHFQQLWGYLLEWQAIFNKFDEDTSGTMNSYELRLALNAAGFHLNNQL
TQTLTSRYRDSRLRVDFERFVSCVAHLTCIFCHCSQHLDGGEGVICLTHRQWMEVATFS
GenBank ID Protein 34534289
UniProtKB/Swiss-Prot ID Q6ZSI9
UniProtKB/Swiss-Prot Entry Name CAN12_HUMAN
PDB IDs Not Available
GenBank Gene ID AK127398
GeneCard ID CAPN12
GenAtlas ID CAPN12
HGNC ID HGNC:13249
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]