You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07581
Secondary Accession Numbers
  • 13289
Name Carcinoembryonic antigen-related cell adhesion molecule 3
Synonyms
  1. CD66d antigen
  2. Carcinoembryonic antigen CGM1
Gene Name CEACAM3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.2
SNPs CEACAM3
Gene Sequence
>759 bp
ATGGGGCCCCCCTCAGCCTCTCCCCACAGAGAATGCATCCCCTGGCAGGGGCTTCTGCTC
ACAGCCTCACTTCTAAACTTCTGGAACCCGCCCACCACTGCCAAGCTCACTATTGAATCC
ATGCCGCTCAGTGTCGCAGAGGGGAAGGAGGTGCTTCTACTTGTCCACAATCTGCCCCAG
CATCTTTTTGGCTACAGCTGGTACAAAGGGGAAAGAGTGGATGGCAACAGTCTAATTGTA
GGATATGTAATAGGAACTCAACAAGCTACCCCAGGGGCCGCATACAGCGGTCGAGAGACA
ATATACACCAATGCATCCCTGCTGATCCAGAATGTCACCCAGAATGACATAGGATTCTAC
ACCCTACAAGTCATAAAGTCAGATCTTGTGAATGAAGAAGCAACTGGACAGTTCCATGTA
TACCAAGAAAATGCCCCAGGCCTTCCTGTGGGGGCCGTCGCCGGCATCGTGACCGGGGTC
CTGGTCGGAGTGGCGCTGGTGGCCGCGCTGGTGTGTTTCCTGCTCCTTGCCAAAACTGGA
AGAACCAGCATCCAGCGTGACCTCAAGGAGCAGCAGCCCCAAGCCCTTGCCCCTGGCCGT
GGTCCCTCCCACAGCTCTGCCTTCTCGATGTCCCCTCTCTCCACTGCCCAGGCCCCCCTA
CCCAACCCCAGGACAGCAGCTTCCATCTATGAGGAATTGCTAAAACATGACACAAACATT
TACTGCCGGATGGACCACAAAGCAGAAGTGGCTTCTTAG
Protein Properties
Number of Residues 252
Molecular Weight 27090.7
Theoretical pI 6.63
Pfam Domain Function
Signals
  • 1-34
Transmembrane Regions
  • 156-176
Protein Sequence
>Carcinoembryonic antigen-related cell adhesion molecule 3
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFY
TLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTG
RTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNI
YCRMDHKAEVAS
GenBank ID Protein 121114300
UniProtKB/Swiss-Prot ID P40198
UniProtKB/Swiss-Prot Entry Name CEAM3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001815.2
GeneCard ID CEACAM3
GenAtlas ID CEACAM3
HGNC ID HGNC:1815
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Streichert T, Ebrahimnejad A, Ganzer S, Flayeh R, Wagener C, Brummer J: The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes. Biochem Biophys Res Commun. 2001 Nov 23;289(1):191-7. [PubMed:11708798 ]
  4. Kuroki M, Arakawa F, Matsuo Y, Oikawa S, Misumi Y, Nakazato H, Matsuoka Y: Molecular cloning of nonspecific cross-reacting antigens in human granulocytes. J Biol Chem. 1991 Jun 25;266(18):11810-7. [PubMed:2050678 ]
  5. Nagel G, Grunert F, Kuijpers TW, Watt SM, Thompson J, Zimmermann W: Genomic organization, splice variants and expression of CGM1, a CD66-related member of the carcinoembryonic antigen gene family. Eur J Biochem. 1993 May 15;214(1):27-35. [PubMed:8508798 ]
  6. Khan WN, Frangsmyr L, Teglund S, Israelsson A, Bremer K, Hammarstrom S: Identification of three new genes and estimation of the size of the carcinoembryonic antigen family. Genomics. 1992 Oct;14(2):384-90. [PubMed:1427854 ]
  7. McCaw SE, Schneider J, Liao EH, Zimmermann W, Gray-Owen SD: Immunoreceptor tyrosine-based activation motif phosphorylation during engulfment of Neisseria gonorrhoeae by the neutrophil-restricted CEACAM3 (CD66d) receptor. Mol Microbiol. 2003 Aug;49(3):623-37. [PubMed:12864848 ]
  8. Schmitter T, Agerer F, Peterson L, Munzner P, Hauck CR: Granulocyte CEACAM3 is a phagocytic receptor of the innate immune system that mediates recognition and elimination of human-specific pathogens. J Exp Med. 2004 Jan 5;199(1):35-46. [PubMed:14707113 ]