You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07591
Secondary Accession Numbers
  • 13299
Name C-type lectin domain family 5 member A
Synonyms
  1. C-type lectin superfamily member 5
  2. MDL-1
  3. Myeloid DAP12-associating lectin 1
Gene Name CLEC5A
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function May be involved in proinflammatory activation of myeloid cells via TYROBP-mediated signaling in a calcium-dependent manner
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:7
Locus 7q33
SNPs CLEC5A
Gene Sequence
>567 bp
ATGAACTGGCACATGATCATCTCTGGGCTTATTGTGGTAGTGCTTAAAGTTGTTGGAATG
ACCTTATTTCTACTTTATTTCCCACAGATTTTTAACAAAAGTAACGATGGTTTCACCACC
ACCAGGAGCTATGGAACAGTCTCACAGATTTTTGGGAGCAGTTCCCCAAGTCCCAACGGC
TTCATTACCACAAGGAGCTATGGAACAGTCTGCCCCAAAGACTGGGAATTTTATCAAGCA
AGATGTTTTTTCTTATCCACTTCTGAATCATCTTGGAATGAAAGCAGGGACTTTTGCAAA
GGAAAAGGATCCACATTGGCAATTGTCAACACGCCAGAGAAACTGAAGTTTCTTCAGGAC
ATAACTGATGCTGAGAAGTATTTTATTGGCTTAATTTACCATCGTGAAGAGAAAAGGTGG
CGTTGGATCAACAACTCTGTGTTCAATGGCAATGTTACCAATCAGAATCAGAATTTCAAC
TGTGCGACCATTGGCCTAACAAAGACATTTGATGCTGCATCATGTGACATCAGCTACCGC
AGGATCTGTGAGAAGAATGCCAAATGA
Protein Properties
Number of Residues 188
Molecular Weight 21521.3
Theoretical pI 9.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 5-27
Protein Sequence
>C-type lectin domain family 5 member A
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNG
FITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
ITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYR
RICEKNAK
GenBank ID Protein 41472352
UniProtKB/Swiss-Prot ID Q9NY25
UniProtKB/Swiss-Prot Entry Name CLC5A_HUMAN
PDB IDs Not Available
GenBank Gene ID AC073647
GeneCard ID CLEC5A
GenAtlas ID CLEC5A
HGNC ID HGNC:2054
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Bakker AB, Baker E, Sutherland GR, Phillips JH, Lanier LL: Myeloid DAP12-associating lectin (MDL)-1 is a cell surface receptor involved in the activation of myeloid cells. Proc Natl Acad Sci U S A. 1999 Aug 17;96(17):9792-6. [PubMed:10449773 ]