You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07609
Secondary Accession Numbers
  • 13318
Name Claudin-3
Synonyms
  1. CPE-R 2
  2. CPE-receptor 2
  3. Clostridium perfringens enterotoxin receptor 2
  4. Rat ventral prostate.1 protein homolog
  5. hRVP1
Gene Name CLDN3
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.23
SNPs CLDN3
Gene Sequence
>663 bp
ATGTCCATGGGCCTGGAGATCACGGGCACCGCGCTGGCCGTGCTGGGCTGGCTGGGCACC
ATCGTGTGCTGCGCGTTGCCCATGTGGCGCGTGTCGGCCTTCATCGGCAGCAACATCATC
ACGTCGCAGAACATCTGGGAGGGCCTGTGGATGAACTGCGTGGTGCAGAGCACCGGCCAG
ATGCAGTGCAAGGTGTACGACTCGCTGCTGGCACTGCCACAGGACCTTCAGGCGGCCCGC
GCCCTCATCGTGGTGGCCATCCTGCTGGCCGCCTTCGGGCTGCTAGTGGCGCTGGTGGGC
GCCCAGTGCACCAACTGCGTGCAGGACGACACGGCCAAGGCCAAGATCACCATCGTGGCA
GGCGTGCTGTTCCTTCTCGCCGCCCTGCTCACCCTCGTGCCGGTGTCCTGGTCGGCCAAC
ACCATTATCCGGGACTTCTACAACCCCGTGGTGCCCGAGGCGCAGAAGCGCGAGATGGGC
GCGGGCCTGTACGTGGGCTGGGCGGCCGCGGCGCTGCAGCTGCTGGGGGGCGCGCTGCTC
TGCTGCTCGTGTCCCCCACGCGAGAAGAAGTACACGGCCACCAAGGTCGTCTACTCCGCG
CCGCGCTCCACCGGCCCGGGAGCCAGCCTGGGCACAGGCTACGACCGCAAGGACTACGTC
TAA
Protein Properties
Number of Residues 220
Molecular Weight 23318.3
Theoretical pI 8.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 9-29
  • 81-101
  • 116-136
  • 160-180
Protein Sequence
>Claudin-3
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
GenBank ID Protein 2570129
UniProtKB/Swiss-Prot ID O15551
UniProtKB/Swiss-Prot Entry Name CLD3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB000714
GeneCard ID CLDN3
GenAtlas ID CLDN3
HGNC ID HGNC:2045
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  3. Peacock RE, Keen TJ, Inglehearn CF: Analysis of a human gene homologous to rat ventral prostate.1 protein. Genomics. 1997 Dec 15;46(3):443-9. [PubMed:9441748 ]
  4. Katahira J, Sugiyama H, Inoue N, Horiguchi Y, Matsuda M, Sugimoto N: Clostridium perfringens enterotoxin utilizes two structurally related membrane proteins as functional receptors in vivo. J Biol Chem. 1997 Oct 17;272(42):26652-8. [PubMed:9334247 ]