You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07680
Secondary Accession Numbers
  • 13389
Name Fibrillin-2
Synonyms Not Available
Gene Name FBN2
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-2- containing microfibrils regulate the early process of elastic fiber assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
proteinaceous extracellular matrix
Function
ion binding
cation binding
metal ion binding
binding
structural molecule activity
extracellular matrix structural constituent
calcium ion binding
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:5
Locus 5q23-q31
SNPs FBN2
Gene Sequence
>8739 bp
ATGGGGAGAAGACGGAGGCTGTGTCTCCAGCTCTACTTCCTGTGGCTGGGCTGTGTGGTG
CTCTGGGCGCAGGGCACGGCCGGCCAGCCTCAGCCTCCTCCGCCCAAGCCGCCCCGGCCC
CAGCCGCCGCCGCAACAGGTTCGGTCCGCTACAGCAGGCTCTGAAGGCGGGTTTCTAGCG
CCCGAGTATCGCGAGGAGGGTGCCGCAGTGGCCAGCCGCGTCCGCCGGCGAGGACAGCAG
GACGTGCTCCGAGGGCCCAACGTGTGCGGCTCCAGATTCCACTCCTACTGCTGCCCTGGA
TGGAAGACGCTCCCTGGAGGAAACCAGTGCATTGTCCCGATTTGTAGAAATAGTTGTGGA
GATGGATTTTGTTCCCGTCCTAACATGTGTACTTGTTCCAGTGGGCAAATATCATCAACC
TGTGGATCAAAATCAATTCAGCAGTGCAGTGTGAGATGCATGAATGGTGGGACCTGTGCA
GATGACCACTGCCAGTGCCAGAAAGGATATATTGGAACTTATTGTGGACAACCTGTCTGT
GAAAATGGATGTCAGAATGGTGGACGTTGCATCGGACCCAACCGCTGTGCTTGTGTTTAT
GGGTTCACTGGTCCACAGTGTGAAAGAGATTACAGGACAGGCCCGTGTTTCACTCAGGTC
AACAACCAGATGTGCCAAGGGCAGCTGACAGGCATTGTCTGCACGAAGACTCTGTGCTGT
GCCACCATTGGACGGGCGTGGGGCCATCCCTGTGAGATGTGTCCAGCCCAGCCTCAGCCC
TGCCGACGGGGTTTCATCCCCAACATCCGCACTGGAGCTTGCCAAGATGTTGATGAATGC
CAGGCTATCCCAGGGATATGCCAAGGAGGAAACTGTATCAATACAGTGGGCTCTTTTGAA
TGCAGATGCCCTGCTGGTCACAAACAGAGTGAAACTACTCAGAAATGTGAAGACATTGAT
GAGTGCAGCATCATTCCTGGGATATGTGAAACTGGTGAATGTTCCAACACCGTGGGAAGC
TATTTTTGTGTTTGTCCACGTGGATATGTAACCTCAACAGATGGCTCTCGATGCATCGAT
CAGAGAACAGGCATGTGTTTCTCGGGCCTGGTGAATGGCCGCTGTGCACAAGAGCTCCCG
GGGAGAATGACGAAAATGCAGTGCTGCTGTGAGCCTGGCCGCTGCTGGGGCATCGGAACC
ATTCCTGAAGCCTGTCCTGTCAGAGGTTCTGAGGAATATCGCAGACTTTGCATGGATGGA
CTTCCAATGGGAGGAATTCCAGGGAGTGCTGGTTCCAGACCTGGAGGCACTGGGGGAAAT
GGCTTTGCCCCAAGTGGCAATGGCAATGGCTATGGCCCAGGAGGGACAGGCTTCATCCCC
ATCCCTGGAGGCAATGGCTTTTCTCCTGGCGTTGGGGGAGCCGGTGTGGGGGCCGGGGGA
CAGGGACCTATCATCACTGGACTAACAATTCTGAACCAGACAATAGATATCTGTAAGCAT
CATGCTAACCTTTGTTTAAATGGACGCTGTATACCAACTGTCTCAAGCTACCGATGTGAA
TGCAACATGGGTTATAAGCAGGATGCAAATGGAGATTGTATAGATGTTGATGAATGCACA
TCAAATCCCTGCACTAATGGAGATTGTGTTAACACACCTGGTTCCTATTATTGTAAATGT
CATGCTGGATTCCAGAGGACTCCTACCAAGCAAGCATGCATTGATATTGATGAGTGCATC
CAGAATGGGGTTCTTTGTAAAAACGGTCGATGCGTGAACACAGATGGAAGTTTCCAGTGC
ATTTGCAATGCCGGCTTTGAATTAACTACAGATGGAAAAAACTGTGTTGATCATGATGAA
TGTACAACTACCAACATGTGTTTGAATGGAATGTGCATCAATGAAGATGGCAGCTTCAAG
TGCATCTGCAAACCAGGATTTGTCTTGGCTCCAAATGGGCGTTACTGTACTGATGTTGAT
GAATGCCAGACCCCAGGAATCTGCATGAATGGGCACTGCATCAACAGTGAAGGGTCCTTC
CGCTGTGACTGTCCCCCAGGCCTGGCTGTGGGCATGGATGGACGTGTGTGTGTTGATACT
CACATGCGCAGTACCTGCTATGGAGGAATCAAGAAAGGAGTGTGTGTGCGTCCTTTCCCC
GGTGCAGTGACCAAGTCCGAATGCTGCTGTGCCAATCCAGACTATGGTTTTGGAGAACCC
TGCCAGCCATGCCCTGCAAAAAATTCAGCTGAATTCCACGGCCTTTGTAGTAGTGGAGTA
GGTATCACTGTGGATGGAAGAGATATCAATGAATGTGCTTTGGATCCTGATATATGTGCC
AATGGGATTTGTGAAAACTTACGTGGTAGTTACCGTTGTAATTGCAACAGTGGCTATGAA
CCAGATGCCTCTGGAAGAAACTGTATTGACATTGATGAATGTTTAGTAAACAGACTGCTT
TGTGATAACGGATTGTGCCGAAACACGCCAGGAAGTTACAGCTGTACGTGCCCACCAGGG
TATGTGTTCAGGACTGAGACAGAGACCTGTGAAGATATAAATGAATGTGAAAGCAACCCA
TGTGTCAATGGGGCCTGCAGAAACAACCTTGGATCTTTCAATTGTGAATGTTCGCCCGGC
AGCAAACTCAGCTCCACAGGATTGATCTGTATTGACAGCCTGAAGGGGACCTGTTGGCTC
AACATCCAGGACAGCCGCTGTGAGGTGAATATTAATGGAGCCACTCTGAAATCTGAATGC
TGTGCCACCCTCGGAGCCGCCTGGGGGAGCCCCTGTGAGCGGTGTGAACTAGATACAGCT
TGCCCAAGAGGGCTTGCCAGGATTAAAGGTGTTACGTGTGAAGATGTTAATGAGTGTGAG
GTGTTCCCTGGCGTTTGTCCAAATGGACGCTGTGTCAACAGTAAGGGATCTTTTCATTGC
GAGTGCCCTGAAGGCCTTACGTTGGATGGGACTGGCCGTGTATGTTTGGATATTCGCATG
GAGCAGTGTTACTTGAAGTGGGATGAAGATGAATGCATCCACCCCGTTCCTGGAAAGTTC
CGCATGGATGCCTGCTGCTGTGCTGTCGGGGCGGCTTGGGGCACCGAGTGTGAGGAGTGC
CCCAAACCTGGCACCAAGGAATACGAGACGCTGTGCCCCCGCGGGGCTGGCTTTGCTAAC
CGAGGGGATGTTCTTACTGGGCGGCCATTTTACAAAGACATCAATGAATGCAAAGCATTT
CCTGGGATGTGCACTTATGGGAAGTGCAGAAATACAATCGGAAGCTTCAAATGCCGTTGC
AATAGTGGCTTTGCTCTAGACATGGAGGAAAGAAACTGCACGGACATCGACGAGTGCAGG
ATTTCTCCTGACCTCTGTGGCAGTGGAATCTGCGTCAATACACCGGGCAGCTTTGAGTGC
GAGTGCTTCGAAGGCTATGAAAGTGGCTTCATGATGATGAAGAACTGCATGGACATTGAC
GAATGTGAACGTAACCCTCTCCTTTGTAGGGGTGGCACCTGTGTGAACACTGAGGGCAGC
TTTCAGTGTGACTGCCCACTGGGACACGAGCTGTCACCATCCCGTGAGGACTGTGTGGAT
ATTAATGAATGCTCCCTGAGTGACAATCTCTGCAGAAATGGAAAATGTGTGAACATGATT
GGAACCTATCAGTGCTCTTGCAATCCTGGATATCAGGCTACGCCAGACCGCCAGGGCTGT
ACAGATATTGATGAATGTATGATAATGAACGGAGGCTGTGACACCCAGTGCACAAATTCA
GAGGGAAGCTACGAATGCAGCTGCAGTGAGGGTTATGCCCTGATGCCAGATGGGAGATCG
TGTGCAGACATTGATGAATGTGAAAACAATCCTGATATCTGTGATGGCGGCCAGTGTACC
AACATTCCTGGAGAGTATCGCTGCCTCTGCTATGATGGCTTCATGGCTTCCATGGACATG
AAAACATGCATTGATGTCAATGAATGTGACCTAAATTCAAATATCTGCATGTTTGGGGAA
TGTGAGAACACAAAGGGATCCTTCATTTGCCACTGTCAGCTGGGTTACTCAGTGAAGAAG
GGGACCACAGGATGTACAGATGTGGATGAGTGTGAAATTGGTGCTCATAACTGCGACATG
CATGCCTCATGTCTGAATATCCCAGGAAGCTTCAAGTGTAGCTGCAGAGAAGGCTGGATT
GGAAACGGCATCAAGTGTATTGATCTGGACGAATGTTCTAATGGAACCCACCAGTGTAGC
ATCAATGCTCAGTGTGTAAATACCCCGGGCTCATACCGCTGTGCCTGCTCCGAAGGTTTC
ACTGGTGATGGCTTTACCTGCTCAGATGTTGATGAGTGTGCAGAAAACATAAACCTCTGT
GAGAACGGACAGTGCCTTAATGTCCCGGGTGCATATCGCTGCGAGTGTGAGATGGGCTTC
ACTCCAGCCTCAGACAGCAGATCCTGCCAAGATATTGATGAATGCTCCTTCCAAAACATT
TGTGTCTTTGGAACATGTAATAACCTGCCTGGAATGTTTCATTGCATCTGCGATGATGGT
TATGAATTGGACAGAACAGGAGGGAACTGTACAGATATTGATGAGTGTGCAGATCCTATA
AACTGTGTCAATGGCCTATGTGTCAACACGCCTGGTCGCTATGAGTGTAACTGCCCACCC
GATTTTCAGTTGAACCCAACTGGTGTGGGTTGTGTTGACAACCGTGTGGGCAACTGCTAC
CTGAAGTTTGGACCTCGAGGAGATGGGAGTCTGTCTTGCAACACCGAGATCGGGGTGGGC
GTCAGTCGCTCTTCATGCTGCTGCTCTCTGGGAAAGGCCTGGGGAAACCCCTGTGAGACA
TGCCCCCCTGTCAATAGCACTGAATATTACACCCTGTGTCCCGGAGGTGAAGGCTTCAGA
CCTAACCCCATCACAATCATTTTAGAAGACATTGACGAATGCCAGGAGTTACCAGGTCTC
TGCCAGGGTGGAAACTGCATCAACACTTTTGGGAGCTTCCAGTGTGAGTGCCCACAAGGC
TACTACCTCAGCGAGGATACCCGCATCTGTGAAGATATTGATGAGTGTTTTGCACATCCT
GGTGTGTGTGGGCCTGGGACCTGCTATAACACCCTGGGAAATTACACCTGCATTTGCCCA
CCTGAGTACATGCAGGTCAATGGAGGCCACAACTGCATGGACATGAGAAAAAGCTTTTGC
TACCGAAGCTATAATGGAACCACTTGTGAGAATGAGTTGCCTTTCAATGTGACAAAAAGG
ATGTGCTGCTGCACATATAATGTGGGCAAAGCCTGGAACAAACCTTGTGAACCATGCCCA
ACTCCAGGAACAGCTGACTTTAAAACCATATGTGGAAATATTCCTGGATTCACCTTTGAC
ATTCACACAGGAAAAGCTGTTGACATTGATGAATGTAAAGAGATTCCAGGCATTTGTGCA
AATGGTGTGTGCATTAACCAGATTGGCAGTTTCCGCTGTGAATGCCCTACAGGATTCAGT
TACAATGACCTGCTGTTGGTTTGTGAAGATATAGATGAGTGCAGCAATGGTGATAATCTC
TGCCAGCGGAATGCAGACTGCATCAATAGTCCTGGTAGTTACCGCTGTGAATGTGCCGCG
GGTTTCAAACTTTCACCCAATGGGGCCTGTGTAGATCGCAATGAATGTTTAGAAATTCCT
AACGTTTGCAGTCATGGCTTGTGTGTTGATCTGCAAGGAAGTTACCAGTGCATCTGCCAC
AATGGCTTTAAGGCTTCTCAGGACCAGACCATGTGCATGGATGTTGATGAGTGCGAGCGG
CATCCATGTGGAAATGGAACTTGTAAAAACACCGTTGGATCCTATAACTGTCTGTGCTAC
CCAGGGTTTGAACTCACTCATAATAATGATTGCCTGGACATAGATGAGTGCAGTTCCTTT
TTTGGTCAGGTGTGCAGAAATGGACGTTGTTTTAATGAAATTGGTTCTTTCAAGTGTCTA
TGTAACGAAGGTTATGAACTTACCCCAGATGGCAAAAACTGTATAGACACTAATGAGTGT
GTCGCCCTTCCCGGCTCTTGCTCTCCTGGTACCTGTCAGAATTTGGAGGGATCCTTCAGA
TGCATCTGTCCCCCAGGGTATGAAGTAAAAAGCGAGAACTGCATTGATATAAATGAATGT
GATGAAGATCCCAACATTTGTCTTTTTGGTTCCTGTACTAATACTCCAGGGGGCTTCCAG
TGCCTCTGCCCCCCTGGCTTTGTACTATCTGATAATGGACGGAGATGCTTTGATACTCGC
CAGAGCTTCTGCTTCACAAATTTTGAAAATGGAAAGTGTTCTGTACCCAAAGCTTTCAAC
ACCACAAAAGCAAAATGCTGCTGTAGTAAGATGCCAGGAGAGGGCTGGGGGGACCCCTGT
GAGCTGTGCCCCAAAGACGATGAAGTTGCATTTCAGGATTTGTGTCCATATGGCCATGGA
ACTGTCCCTAGTCTTCATGATACACGTGAAGATGTCAATGAGTGTCTTGAGAGCCCAGGC
ATTTGTTCAAATGGTCAATGTATCAACACCGACGGATCTTTTCGCTGTGAATGTCCAATG
GGCTACAACCTTGACTACACTGGAGTACGCTGTGTGGATACTGATGAGTGTTCAATCGGC
AATCCGTGTGGAAATGGTACATGCACCAATGTTATTGGGAGTTTTGAATGCAATTGCAAT
GAAGGCTTTGAGCCAGGGCCCATGATGAATTGTGAAGATATCAACGAATGTGCCCAGAAC
CCACTGCTGTGTGCTTTCCGCTGCATGAACACTTTTGGGTCCTATGAATGCACGTGCCCG
ATTGGCTATGCCCTCAGGGAAGATCAAAAGATGTGCAAAGATCTGGATGAATGTGCTGAA
GGGTTACACGACTGTGAATCTAGGGGCATGATGTGTAAGAATCTAATCGGCACCTTCATG
TGCATCTGCCCTCCTGGAATGGCCCGAAGGCCCGATGGAGAAGGCTGTGTAGATGAAAAT
GAATGCAGGACCAAGCCAGGAATCTGTGAAAATGGACGTTGTGTTAACATTATTGGAAGC
TATAGATGTGAGTGTAATGAAGGATTCCAGTCAAGTTCTTCAGGCACTGAATGCCTTGAC
AATCGACAGGGTCTCTGCTTTGCAGAGGTACTGCAGACAATATGTCAAATGGCATCCAGT
AGTCGCAATCTCGTCACTAAGTCAGAATGCTGCTGTGATGGTGGGCGAGGCTGGGGCCAC
CAGTGCGAGCTTTGCCCACTTCCTGGAACTGCCCAGTACAAAAAGATATGTCCTCATGGC
CCAGGATATACAACTGATGGAAGAGATATTGATGAATGTAAGGTAATGCCAAACCTCTGC
ACCAATGGTCAGTGCATCAATACCATGGGCTCATTCCGATGCTTCTGCAAGGTTGGCTAC
ACCACAGACATCAGTGGAACCTCTTGTATAGACCTTGATGAATGCTCCCAGTCCCCGAAA
CCATGCAACTACATCTGCAAGAACACTGAGGGGAGTTATCAGTGTTCATGTCCGAGGGGG
TATGTCCTGCAAGAGGATGGAAAGACATGCAAAGACCTTGATGAATGTCAAACAAAGCAG
CATAACTGCCAGTTCCTCTGTGTCAACACCCTGGGGGGGTTTACCTGTAAATGTCCACCT
GGTTTCACACAGCATCACACTGCTTGTATCGACAACAACGAATGTGGGTCTCAACCTTCG
CTTTGTGGAGCAAAGGGAATCTGTCAAAACACTCCAGGCAGTTTCAGCTGTGAATGCCAA
AGAGGGTTCTCTCTTGATGCCACCGGACTGAACTGTGAAGATGTTGATGAATGTGATGGG
AACCACAGGTGCCAACACGGCTGCCAGAACATCCTGGGTGGCTACAGATGTGGCTGCCCC
CAAGGCTACATCCAGCACTACCAGTGGAATCAGTGTGTCGATGAGAATGAATGCTCCAAT
CCCAATGCCTGTGGCTCTGCTTCCTGCTACAACACCCTGGGGAGTTACAAGTGCGCCTGC
CCCTCGGGGTTCTCCTTCGACCAGTTCTCCAGTGCCTGCCACGACGTGAATGAGTGCTCG
TCCTCCAAGAACCCCTGCAATTACGGCTGCTCTAACACGGAGGGGGGCTACCTCTGTGGC
TGCCCCCCTGGGTATTACAGAGTGGGACAAGGCCACTGTGTCTCAGGAATGGGATTTAAC
AAGGGGCAGTACCTGTCACTGGATACAGAGGTCGATGAGGAAAATGCTCTGTCCCCAGAA
GCATGCTACGAGTGCAAAATCAACGGCTATTCTAAGAAAGACAGCAGGCAGAAGAGAAGT
ATTCATGAACCTGATCCCACTGCTGTTGAACAGATCAGCCTAGAGAGTGTCGACATGGAC
AGCCCCGTCAACATGAAGTTCAACCTCTCCCACCTCGGCTCTAAGGAGCACATCCTGGAA
CTAAGGCCCGCCATCCAGCCCCTCAACAACCACATCCGTTATGTCATCTCTCAAGGGAAC
GATGACAGCGTCTTCCGCATCCACCAAAGGAATGGGCTCAGCTACTTGCACACGGCCAAG
AAGAAGCTCATGCCCGGCACATACACACTGGAAATCACTAGCATCCCTCTCTACAAGAAG
AAGGAGCTTAAGAAACTGGAAGAGAGCAATGAGGATGACTACCTCCTAGGGGAGCTTGGG
GAGGCTCTCAGAATGAGGCTGCAGATTCAGCTCTATTAA
Protein Properties
Number of Residues 2912
Molecular Weight 314772.2
Theoretical pI 4.47
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • None
Protein Sequence
>Fibrillin-2
MGRRRRLCLQLYFLWLGCVVLWAQGTAGQPQPPPPKPPRPQPPPQQVRSATAGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKF
RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF
PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFEC
ECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD
INECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNS
EGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM
KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDM
HASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF
TGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNI
CVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPP
DFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET
CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQG
YYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFC
YRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFD
IHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL
CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICH
NGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF
FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFR
CICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR
QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHG
TVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG
NPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCP
IGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDEN
ECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASS
SRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLC
TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRG
YVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPS
LCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCP
QGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECS
SSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPE
ACYECKINGYSKKDSRQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILE
LRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIPLYKK
KELKKLEESNEDDYLLGELGEALRMRLQIQLY
GenBank ID Protein 66346695
UniProtKB/Swiss-Prot ID P35556
UniProtKB/Swiss-Prot Entry Name FBN2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001999.3
GeneCard ID FBN2
GenAtlas ID FBN2
HGNC ID HGNC:3604
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  4. Lee B, Godfrey M, Vitale E, Hori H, Mattei MG, Sarfarazi M, Tsipouras P, Ramirez F, Hollister DW: Linkage of Marfan syndrome and a phenotypically related disorder to two different fibrillin genes. Nature. 1991 Jul 25;352(6333):330-4. [PubMed:1852206 ]
  5. Zhang H, Apfelroth SD, Hu W, Davis EC, Sanguineti C, Bonadio J, Mecham RP, Ramirez F: Structure and expression of fibrillin-2, a novel microfibrillar component preferentially located in elastic matrices. J Cell Biol. 1994 Mar;124(5):855-63. [PubMed:8120105 ]
  6. Putnam EA, Zhang H, Ramirez F, Milewicz DM: Fibrillin-2 (FBN2) mutations result in the Marfan-like disorder, congenital contractural arachnodactyly. Nat Genet. 1995 Dec;11(4):456-8. [PubMed:7493032 ]
  7. Park ES, Putnam EA, Chitayat D, Child A, Milewicz DM: Clustering of FBN2 mutations in patients with congenital contractural arachnodactyly indicates an important role of the domains encoded by exons 24 through 34 during human development. Am J Med Genet. 1998 Jul 24;78(4):350-5. [PubMed:9714438 ]
  8. Babcock D, Gasner C, Francke U, Maslen C: A single mutation that results in an Asp to His substitution and partial exon skipping in a family with congenital contractural arachnodactyly. Hum Genet. 1998 Jul;103(1):22-8. [PubMed:9737771 ]
  9. Belleh S, Zhou G, Wang M, Der Kaloustian VM, Pagon RA, Godfrey M: Two novel fibrillin-2 mutations in congenital contractural arachnodactyly. Am J Med Genet. 2000 May 1;92(1):7-12. [PubMed:10797416 ]
  10. Gupta PA, Putnam EA, Carmical SG, Kaitila I, Steinmann B, Child A, Danesino C, Metcalfe K, Berry SA, Chen E, Delorme CV, Thong MK, Ades LC, Milewicz DM: Ten novel FBN2 mutations in congenital contractural arachnodactyly: delineation of the molecular pathogenesis and clinical phenotype. Hum Mutat. 2002 Jan;19(1):39-48. [PubMed:11754102 ]
  11. Callewaert BL, Loeys BL, Ficcadenti A, Vermeer S, Landgren M, Kroes HY, Yaron Y, Pope M, Foulds N, Boute O, Galan F, Kingston H, Van der Aa N, Salcedo I, Swinkels ME, Wallgren-Pettersson C, Gabrielli O, De Backer J, Coucke PJ, De Paepe AM: Comprehensive clinical and molecular assessment of 32 probands with congenital contractural arachnodactyly: report of 14 novel mutations and review of the literature. Hum Mutat. 2009 Mar;30(3):334-41. doi: 10.1002/humu.20854. [PubMed:19006240 ]