Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07695
Secondary Accession Numbers
  • 13404
Name Furin
Synonyms
  1. Dibasic-processing enzyme
  2. PACE
  3. Paired basic amino acid residue-cleaving enzyme
Gene Name FURIN
Protein Type Unknown
Biological Properties
General Function Involved in serine-type endopeptidase activity
Specific Function Furin is likely to represent the ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RX(K/R)R consensus motif
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
serine-type endopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cell membrane
  2. Golgi apparatus
  3. Single-pass type I membrane protein
  4. Single-pass type I membrane protein
  5. trans-Golgi network membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs FURIN
Gene Sequence
>2385 bp
ATGGAGCTGAGGCCCTGGTTGCTATGGGTGGTAGCAGCAACAGGAACCTTGGTCCTGCTA
GCAGCTGATGCTCAGGGCCAGAAGGTCTTCACCAACACGTGGGCTGTGCGCATCCCTGGA
GGCCCAGCGGTGGCCAACAGTGTGGCACGGAAGCATGGGTTCCTCAACCTGGGCCAGATC
TTCGGGGACTATTACCACTTCTGGCATCGAGGAGTGACGAAGCGGTCCCTGTCGCCTCAC
CGCCCGCGGCACAGCCGGCTGCAGAGGGAGCCTCAAGTACAGTGGCTGGAACAGCAGGTG
GCAAAGCGACGGACTAAACGGGACGTGTACCAGGAGCCCACAGACCCCAAGTTTCCTCAG
CAGTGGTACCTGTCTGGTGTCACTCAGCGGGACCTGAATGTGAAGGCGGCCTGGGCGCAG
GGCTACACAGGGCACGGCATTGTGGTCTCCATTCTGGACGATGGCATCGAGAAGAACCAC
CCGGACTTGGCAGGCAATTATGATCCTGGGGCCAGTTTTGATGTCAATGACCAGGACCCT
GACCCCCAGCCTCGGTACACACAGATGAATGACAACAGGCACGGCACACGGTGTGCGGGG
GAAGTGGCTGCGGTGGCCAACAACGGTGTCTGTGGTGTAGGTGTGGCCTACAACGCCCGC
ATTGGAGGGGTGCGCATGCTGGATGGCGAGGTGACAGATGCAGTGGAGGCACGCTCGCTG
GGCCTGAACCCCAACCACATCCACATCTACAGTGCCAGCTGGGGCCCCGAGGATGACGGC
AAGACAGTGGATGGGCCAGCCCGCCTCGCCGAGGAGGCCTTCTTCCGTGGGGTTAGCCAG
GGCCGAGGGGGGCTGGGCTCCATCTTTGTCTGGGCCTCGGGGAACGGGGGCCGGGAACAT
GACAGCTGCAACTGCGACGGCTACACCAACAGTATCTACACGCTGTCCATCAGCAGCGCC
ACGCAGTTTGGCAACGTGCCGTGGTACAGCGAGGCCTGCTCGTCCACACTGGCCACGACC
TACAGCAGTGGCAACCAGAATGAGAAGCAGATCGTGACGACTGACTTGCGGCAGAAGTGC
ACGGAGTCTCACACGGGCACCTCAGCCTCTGCCCCCTTAGCAGCCGGCATCATTGCTCTC
ACCCTGGAGGCCAATAAGAACCTCACATGGCGGGACATGCAACACCTGGTGGTACAGACC
TCGAAGCCAGCCCACCTCAATGCCAACGACTGGGCCACCAATGGTGTGGGCCGGAAAGTG
AGCCACTCATATGGCTACGGGCTTTTGGACGCAGGCGCCATGGTGGCCCTGGCCCAGAAT
TGGACCACAGTGGCCCCCCAGCGGAAGTGCATCATCGACATCCTCACCGAGCCCAAAGAC
ATCGGGAAACGGCTCGAGGTGCGGAAGACCGTGACCGCGTGCCTGGGCGAGCCCAACCAC
ATCACTCGGCTGGAGCACGCTCAGGCGCGGCTCACCCTGTCCTATAATCGCCGTGGCGAC
CTGGCCATCCACCTGGTCAGCCCCATGGGCACCCGCTCCACCCTGCTGGCAGCCAGGCCA
CATGACTACTCCGCAGATGGGTTTAATGACTGGGCCTTCATGACAACTCATTCCTGGGAT
GAGGATCCCTCTGGCGAGTGGGTCCTAGAGATTGAAAACACCAGCGAAGCCAACAACTAT
GGGACGCTGACCAAGTTCACCCTCGTACTCTATGGCACCGCCCCTGAGGGGCTGCCCGTA
CCTCCAGAAAGCAGTGGCTGCAAGACCCTCACGTCCAGTCAGGCCTGTGTGGTGTGCGAG
GAAGGCTTCTCCCTGCACCAGAAGAGCTGTGTCCAGCACTGCCCTCCAGGCTTCGCCCCC
CAAGTCCTCGATACGCACTATAGCACCGAGAATGACGTGGAGACCATCCGGGCCAGCGTC
TGCGCCCCCTGCCACGCCTCATGTGCCACATGCCAGGGGCCGGCCCTGACAGACTGCCTC
AGCTGCCCCAGCCACGCCTCCTTGGACCCTGTGGAGCAGACTTGCTCCCGGCAAAGCCAG
AGCAGCCGAGAGTCCCCGCCACAGCAGCAGCCACCTCGGCTGCCCCCGGAGGTGGAGGCG
GGGCAACGGCTGCGGGCAGGGCTGCTGCCCTCACACCTGCCTGAGGTGGTGGCCGGCCTC
AGCTGCGCCTTCATCGTGCTGGTCTTCGTCACTGTCTTCCTGGTCCTGCAGCTGCGCTCT
GGCTTTAGTTTTCGGGGGGTGAAGGTGTACACCATGGACCGTGGCCTCATCTCCTACAAG
GGGCTGCCCCCTGAAGCCTGGCAGGAGGAGTGCCCGTCTGACTCAGAAGAGGACGAGGGC
CGGGGCGAGAGGACCGCCTTTATCAAAGACCAGAGCGCCCTCTGA
Protein Properties
Number of Residues 794
Molecular Weight 86677.4
Theoretical pI 6.44
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • 716-738
Protein Sequence
>Furin
MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL
GenBank ID Protein 31478
UniProtKB/Swiss-Prot ID P09958
UniProtKB/Swiss-Prot Entry Name FURIN_HUMAN
PDB IDs
GenBank Gene ID X17094
GeneCard ID FURIN
GenAtlas ID FURIN
HGNC ID HGNC:8568
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. van den Ouweland AM, van Duijnhoven HL, Keizer GD, Dorssers LC, Van de Ven WJ: Structural homology between the human fur gene product and the subtilisin-like protease encoded by yeast KEX2. Nucleic Acids Res. 1990 Feb 11;18(3):664. [PubMed:2408021 ]
  3. Wise RJ, Barr PJ, Wong PA, Kiefer MC, Brake AJ, Kaufman RJ: Expression of a human proprotein processing enzyme: correct cleavage of the von Willebrand factor precursor at a paired basic amino acid site. Proc Natl Acad Sci U S A. 1990 Dec;87(23):9378-82. [PubMed:2251280 ]
  4. Barr PJ, Mason OB, Landsberg KE, Wong PA, Kiefer MC, Brake AJ: cDNA and gene structure for a human subtilisin-like protease with cleavage specificity for paired basic amino acid residues. DNA Cell Biol. 1991 Jun;10(5):319-28. [PubMed:1713771 ]
  5. Van den Ouweland AM, Van Groningen JJ, Roebroek AJ, Onnekink C, Van de Ven WJ: Nucleotide sequence analysis of the human fur gene. Nucleic Acids Res. 1989 Sep 12;17(17):7101-2. [PubMed:2674906 ]
  6. Roebroek AJ, Schalken JA, Leunissen JA, Onnekink C, Bloemers HP, Van de Ven WJ: Evolutionary conserved close linkage of the c-fes/fps proto-oncogene and genetic sequences encoding a receptor-like protein. EMBO J. 1986 Sep;5(9):2197-202. [PubMed:3023061 ]
  7. Takahashi S, Kasai K, Hatsuzawa K, Kitamura N, Misumi Y, Ikehara Y, Murakami K, Nakayama K: A mutation of furin causes the lack of precursor-processing activity in human colon carcinoma LoVo cells. Biochem Biophys Res Commun. 1993 Sep 15;195(2):1019-26. [PubMed:7690548 ]
  8. Takahashi S, Nakagawa T, Kasai K, Banno T, Duguay SJ, Van de Ven WJ, Murakami K, Nakayama K: A second mutant allele of furin in the processing-incompetent cell line, LoVo. Evidence for involvement of the homo B domain in autocatalytic activation. J Biol Chem. 1995 Nov 3;270(44):26565-9. [PubMed:7592877 ]
  9. Leduc R, Molloy SS, Thorne BA, Thomas G: Activation of human furin precursor processing endoprotease occurs by an intramolecular autoproteolytic cleavage. J Biol Chem. 1992 Jul 15;267(20):14304-8. [PubMed:1629222 ]
  10. Siezen RJ, Creemers JW, Van de Ven WJ: Homology modelling of the catalytic domain of human furin. A model for the eukaryotic subtilisin-like proprotein convertases. Eur J Biochem. 1994 Jun 1;222(2):255-66. [PubMed:8020465 ]
  11. Jones BG, Thomas L, Molloy SS, Thulin CD, Fry MD, Walsh KA, Thomas G: Intracellular trafficking of furin is modulated by the phosphorylation state of a casein kinase II site in its cytoplasmic tail. EMBO J. 1995 Dec 1;14(23):5869-83. [PubMed:8846780 ]
  12. Crump CM, Xiang Y, Thomas L, Gu F, Austin C, Tooze SA, Thomas G: PACS-1 binding to adaptors is required for acidic cluster motif-mediated protein traffic. EMBO J. 2001 May 1;20(9):2191-201. [PubMed:11331585 ]