You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07723
Secondary Accession Numbers
  • 13432
Name Guanylyl cyclase-activating protein 2
Synonyms
  1. GCAP 2
  2. Guanylate cyclase activator 1B
Gene Name GUCA1B
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low, and GC1 and GC2 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Cell membrane
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.1
SNPs GUCA1B
Gene Sequence
>603 bp
ATGGGGCAGGAGTTTAGCTGGGAGGAGGCGGAGGCAGCTGGCGAGATAGATGTGGCGGAG
CTCCAGGAGTGGTACAAGAAGTTTGTGATGGAGTGCCCCAGCGGCACACTCTTTATGCAT
GAGTTTAAGCGCTTCTTCAAGGTCACAGACGATGAGGAGGCCTCCCAGTATGTAGAGGGC
ATGTTCCGAGCCTTCGACAAGAATGGGGACAACACCATCGACTTCCTGGAGTACGTGGCA
GCTCTGAATCTCGTGCTGAGGGGCACCCTGGAGCACAAGCTGAAGTGGACATTCAAGATC
TATGATAAGGATGGCAATGGCTGCATCGACCGCCTGGAGCTACTCAACATTGTGGAGGGA
ATTTACCAGCTGAAGAAAGCCTGCCGGCGAGAGCTACAGACTGAGCAAGACCAGCTGCTC
ACACCCGAGGAGGTCGTGGACAGGATCTTCCTCCTGGTGGATGAGAATGGAGATGGCCAG
CTGTCTCTGAACGAGTTTGTTGAAGGTGCCCGTCGGGACAAGTGGGTGATGAAGATGCTG
CAGATGGACATGAATCCCAGCAGCTGGCTCGCTCAGCAGAGACGGAAAAGTGCCATGTTC
TGA
Protein Properties
Number of Residues 200
Molecular Weight 23419.5
Theoretical pI 4.47
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanylyl cyclase-activating protein 2
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG
IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML
QMDMNPSSWLAQQRRKSAMF
GenBank ID Protein 5702369
UniProtKB/Swiss-Prot ID Q9UMX6
UniProtKB/Swiss-Prot Entry Name GUC1B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF173229
GeneCard ID GUCA1B
GenAtlas ID GUCA1B
HGNC ID HGNC:4679
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Surguchov A, Bronson JD, Banerjee P, Knowles JA, Ruiz C, Subbaraya I, Palczewski K, Baehr W: The human GCAP1 and GCAP2 genes are arranged in a tail-to-tail array on the short arm of chromosome 6 (p21.1). Genomics. 1997 Feb 1;39(3):312-22. [PubMed:9119368 ]
  3. Payne AM, Downes SM, Bessant DA, Plant C, Moore T, Bird AC, Bhattacharya SS: Genetic analysis of the guanylate cyclase activator 1B (GUCA1B) gene in patients with autosomal dominant retinal dystrophies. J Med Genet. 1999 Sep;36(9):691-3. [PubMed:10507726 ]