You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07724
Secondary Accession Numbers
  • 13433
Name Guanylyl cyclase-activating protein 3
Synonyms
  1. GCAP 3
  2. Guanylate cyclase activator 1C
Gene Name GUCA1C
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)- sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3q13.1
SNPs GUCA1C
Gene Sequence
>630 bp
ATGGGGAATGGCAAATCTATAGCTGGTGATCAGAAAGCAGTTCCTACACAAGAGACCCAT
GTGTGGTACAGAACATTTATGATGGAATATCCATCCGGCCTGCAAACACTACATGAATTT
AAGACACTTTTGGGTCTGCAAGGTCTGAATCAGAAGGCCAATAAACATATTGATCAAGTT
TATAATACCTTTGACACGAACAAGGATGGATTTGTTGACTTTTTGGAGTTTATTGCTGCT
GTAAATCTAATCATGCAAGAAAAAATGGAGCAAAAATTAAAATGGTATTTTAAGCTGTAT
GATGCTGATGGAAATGGTTCTATTGACAAAAATGAACTACTGGACATGTTCATGGCGGTA
CAAGCCCTCAATGGCCAGCAAACTCTGAGTCCTGAAGAATTCATCAACTTGGTGTTCCAT
AAGATCGATATAAACAATGATGGGGAATTGACTTTAGAAGAATTTATCAATGGCATGGCA
AAAGATCAGGATCTCCTGGAGATTGTTTACAAGAGCTTCGACTTCTCCAATGTGCTGAGA
GTAATCTGTAATGGGAAGCAGCCAGACATGGAGACAGACTCCTCCAAATCTCCTGACAAG
GCTGGTCTAGGGAAGGTGAAAATGAAGTAG
Protein Properties
Number of Residues 209
Molecular Weight 23822.0
Theoretical pI 4.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanylyl cyclase-activating protein 3
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
GenBank ID Protein 4406344
UniProtKB/Swiss-Prot ID O95843
UniProtKB/Swiss-Prot Entry Name GUC1C_HUMAN
PDB IDs Not Available
GenBank Gene ID AF110001
GeneCard ID GUCA1C
GenAtlas ID GUCA1C
HGNC ID HGNC:4680
References
General References
  1. Haeseleer F, Sokal I, Li N, Pettenati M, Rao N, Bronson D, Wechter R, Baehr W, Palczewski K: Molecular characterization of a third member of the guanylyl cyclase-activating protein subfamily. J Biol Chem. 1999 Mar 5;274(10):6526-35. [PubMed:10037746 ]
  2. Stephen R, Palczewski K, Sousa MC: The crystal structure of GCAP3 suggests molecular mechanism of GCAP-linked cone dystrophies. J Mol Biol. 2006 Jun 2;359(2):266-75. Epub 2006 Apr 3. [PubMed:16626734 ]