You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07745
Secondary Accession Numbers
  • 13454
Name Inositol 1,4,5-trisphosphate receptor type 2
Synonyms
  1. IP3 receptor isoform 2
  2. IP3R 2
  3. InsP3R2
  4. Type 2 InsP3 receptor
  5. Type 2 inositol 1,4,5-trisphosphate receptor
Gene Name ITPR2
Protein Type Unknown
Biological Properties
General Function Involved in calcium channel activity
Specific Function Receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
endoplasmic reticulum
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
intracellular ligand-gated ion channel activity
inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
ligand-gated ion channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p11
SNPs ITPR2
Gene Sequence
>8106 bp
ATGACTGAGAAAATGTCCAGCTTCCTCTACATAGGGGACATCGTGTCCCTGTACGCGGAG
GGCTCGGTCAACGGCTTCATCAGCACCTTGGGGTTAGTGGATGACAGATGTGTGGTGCAC
CCAGAGGCCGGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTG
TGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGGAAAGCAAAGCAAGCCAAACAA
GGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAA
AAACAAAATGAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTT
ATACAACTACTGCATATAAAAAGCAACAAATATCTTACTGTCAACAAGAGATTACCTGCT
TTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGG
TTTTATATTCATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGAT
AAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTACATGCCAGCAACATAGAGCTT
CTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATC
ACTTTATTCATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTT
AGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGTGATGAATATGAGAAAAAACAG
CACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCA
CTCTGGGAAATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAAC
AGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTATTTAGCTGCAGAGCTTAATCCT
GATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCA
AAGAAAAAACGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGC
AATGACATTGCATCCCTTTTTGAACTAGATGCCACAACTCTTCAGAGAGCTGACTGCCTG
GTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGT
ACTAGTATCCCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGC
CAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCTGTTCCACTGTCTGAAGTTCGA
GACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAA
AACGGCACAATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATA
TTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTTCTGGATGTGGTTATCACTAAG
CCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGA
ATTCTTAAAGCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGAT
CTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTGCGGCTCTGTTACCGCGTCCTG
AGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTC
ATGCAGTCCCAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCAC
AACAACAGAAAACTACTAGAGAAACATATCACAGCAAAAGAAATAGAAACATTTGTCAGT
TTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCT
AATACCACTGCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGC
AATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATGCAAGCAGACAACCCCATGGAG
AGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGC
AACAAGGAACCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACC
AAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAGCTAAACCTCTTTGCAAGGATG
TGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTG
ATCCTGCGGTGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGC
CTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAGTCCGTGGTGCCTGTTCGCTAT
GCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACA
GACTCTTCCAGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAA
TATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGGGATAAAGAAAAAAATAAACTG
ACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGT
GAGTTATTAAGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATG
TCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGAGGAAACAATGTGATGAGAACC
ATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCC
ATGAGCGTGCCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAG
CACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATCATTGAGATTTTGCAGTTTATC
CTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTT
GGAGAGGACAATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCA
TCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAGGCAGAAACTATGTTTGCGGGA
AGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTC
CTCATTCATCTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTG
TTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCATTTAAGCAGGTGCAATTACTG
GTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGA
CTGACAGTAGAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAA
ATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATTGAGGAATCAAACATTTTAAGT
CCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGG
ATTGTAAAGGAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGG
AATCAACATCAACGATTACTGAAAAATATGGGGGCGCATTCGGTGGTGTTGGATCTTCTG
CAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACA
TTTCTGCAGAATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTG
AATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACCATGCGGCACATCTTCATGAAC
AATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATT
GAGACACATGGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGAT
GGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACAGAGTTGATAAATGGGGGTGAA
GACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGT
TCAGAGAGAGACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAG
TTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACTGAAATCAAGTGTAATTCCCTT
CTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAA
ATTGCTTATGTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAA
ATCTATACAAGTAACCACATTTGGAAATTATTTGAGAACTTCTTGGTGGATATGGCAAGG
GTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACT
GAGTCAATAATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACC
AGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTGCAATCTGCCTTCAGAATTTAC
AATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTG
GCTGAAGTGGCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAAT
ACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGAGCAGCAATGGGTTGGAGACTA
TCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGA
AATATTATTGAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATG
ATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTACAGTCCAGAACTGCTGTTCCCT
GAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACA
AAGAAACTAATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAA
ATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAACACATTAAGAAAGATACTTCTG
AATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTAC
TCCAAAACTGCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATA
TCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGTGCATCAGAACTTGTCATCGAT
GTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCC
TTGCTTGAAGGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAA
AAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGAATGAAGGCTGCTCAGAAAGAA
ATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGAC
AATGAATTGATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAA
GAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCAACATCCAAAGCATATTGTGTA
TACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAAC
ACTGAGGAAAAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCA
ATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAACCGGGAATTGCAGAACTTCTTG
AGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGAC
TGCATTTGTGGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAG
AATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACTGAGTATTGCCAGGGCCCTTGC
CATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCT
TTGATTCTGAATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTA
AAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAAAGCAGACATGACAGTGAGAAT
GCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCC
TATAACCAAGGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCT
CCAAAAGATGTTGGACACAATATCTATATTCTGGCCCATCAGTTGGCCCGCCACAATAAA
CTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAG
TATTATGCCAACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAA
ATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACTCGAGAATCCAAGTGCCGTGTG
TTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACA
GAAGATCTCTACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTC
TGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCCTTCAACCTGGCTGTGTTCATC
AATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCT
CCATTGTTCTCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTC
TTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCAATAATGCTCAGATCAATATAT
ACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATT
GTTTTTCTGGTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTC
ATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTCCTGGTTTGCATGCTGGGCCTT
TTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACT
TTGCTGAATGTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTC
CTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGGTTCCTTTTTTTGAAGGATGAC
TTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTG
CCTACTATGACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACA
ATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGATGGAATTGAAAGGACGTGTGAC
ACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTG
GGGGATGTGCTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTAT
GACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTGAACTTGATTTTTGGTGTTATC
ATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACA
ACTTGTTTCATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAG
GAGCACATTAAGTCAGAACACAATATGTGGCATTATTTGTACTTCATAGTCCTGGTGAAA
GTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAG
AAGAATTTGGATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGAC
AGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTGGAATCGACCATGAGTCTGGTC
AAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAAT
AAGCAGAGACTGGGCTTCCTCGGATCAAACACACCCCATGTGAATCATCACATGCCACCA
CACTGA
Protein Properties
Number of Residues 2701
Molecular Weight 308061.1
Theoretical pI 6.39
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 2228-2248
  • 2261-2281
  • 2308-2328
  • 2352-2372
  • 2395-2415
  • 2522-2542
Protein Sequence
>Inositol 1,4,5-trisphosphate receptor type 2
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQNLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
GenBank ID Protein 95147335
UniProtKB/Swiss-Prot ID Q14571
UniProtKB/Swiss-Prot Entry Name ITPR2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002223.2
GeneCard ID ITPR2
GenAtlas ID ITPR2
HGNC ID HGNC:6181
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  5. Yang J, McBride S, Mak DO, Vardi N, Palczewski K, Haeseleer F, Foskett JK: Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7711-6. [PubMed:12032348 ]
  6. Yamamoto-Hino M, Sugiyama T, Hikichi K, Mattei MG, Hasegawa K, Sekine S, Sakurada K, Miyawaki A, Furuichi T, Hasegawa M, et al.: Cloning and characterization of human type 2 and type 3 inositol 1,4,5-trisphosphate receptors. Receptors Channels. 1994;2(1):9-22. [PubMed:8081734 ]
  7. Futatsugi A, Kuwajima G, Mikoshiba K: Muscle-specific mRNA isoform encodes a protein composed mainly of the N-terminal 175 residues of type 2 Ins(1,4,5)P3 receptor. Biochem J. 1998 Sep 15;334 ( Pt 3):559-63. [PubMed:9729462 ]