Showing Protein Kv channel-interacting protein 2 (HMDBP07751)

• 13460

1. A-type potassium channel modulatory protein 2
2. Cardiac voltage-gated potassium channel modulatory subunit
3. KChIP2
4. Potassium channel-interacting protein 2

• 3-Methylthiofentanyl Action Pathway
• Acebutolol Action Pathway
• Alfentanil Action Pathway
• Alprenolol Action Pathway
• Alvimopan Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Anileridine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Benzocaine Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Bopindolol Action Pathway
• Bupivacaine Action Pathway
• Bupranolol Action Pathway
• Buprenorphine Action Pathway
• Carfentanil Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Chloroprocaine Action Pathway
• Citalopram Action Pathway
• Cocaine Action Pathway
• Codeine Action Pathway
• Desipramine Action Pathway
• Dezocine Action Pathway
• Dibucaine Action Pathway
• Dihydromorphine Action Pathway
• Diltiazem Action Pathway
• Dimethylthiambutene Action Pathway
• Diphenoxylate Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Escitalopram Action Pathway
• Esmolol Action Pathway
• Ethylmorphine Action Pathway
• Felodipine Action Pathway
• Fentanyl Action Pathway
• Flecainide Action Pathway
• Fluoxetine Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Heroin Action Pathway
• Hydrocodone Action Pathway
• Hydromorphone Action Pathway
• Ibutilide Action Pathway
• Imipramine Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Ketobemidone Action Pathway
• Labetalol Action Pathway
• Levallorphan Action Pathway
• Levobunolol Action Pathway
• Levobupivacaine Action Pathway
• Levomethadyl Acetate Action Action Pathway
• Levorphanol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Lidocaine (Local Anaesthetic) Action Pathway
• Mepivacaine Action Pathway
• Methadone Action Pathway
• Methadyl Acetate Action Pathway
• Metipranolol Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Morphine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nalbuphine Action Pathway
• Naloxone Action Pathway
• Naltrexone Action Pathway
• Nebivolol Action Pathway
• Nicotine Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Oxybuprocaine Action Pathway
• Oxycodone Action Pathway
• Oxymorphone Action Pathway
• Penbutolol Action Pathway
• Pentazocine Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Practolol Action Pathway
• Prilocaine Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Procaine Action Pathway
• Proparacaine Action Pathway
• Propoxyphene Action Pathway
• Propranolol Action Pathway
• Quinidine Action Pathway
• Remifentanil Action Pathway
• Ropivacaine Action Pathway
• Sotalol Action Pathway
• Sufentanil Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Tramadol Action Action Pathway
• Verapamil Action Pathway

1. Lipid-anchor
2. Isoform 6:Cell membrane

>813 bp
ATGCGGGGCCAGGGCCGCAAGGAGAGTTTGTCCGATTCCCGAGACCTGGACGGCTCCTAC
GACCAGCTCACGGGCCACCCTCCGGGGCCCACTAAAAAAGCGCTGAAGCAGCGGTTCCTC
AAGCTGCTGCCGTGCTGCGGGCCCCAAGTCCTGCCCTCAGTCAGTGAAACATTAGCCGCC
CCAGCCTCCCTCCGCCCCCACAGACCCCGCCCGCTGGACCCAGACAGCGTGGAGGATGAA
TTTGAACTGTCCACTGTGTGTCACCGGCCCGAGGGTCTGGAACAACTGCAGGAGCAAACC
AAGTTCACACGCAAGGAGTTGCAGGTCCTGTACCGAGGCTTCAAGAACGAGTGTCCCAGC
GGAATCGTCAATGAGGAGAACTTCAAGCAGATTTACTCCCAGTTCTTTCCTCAAGGAGAC
TCCAGCACCTACGCTACTTTTCTCTTCAATGCCTTTGACACCAACCACGACGGCTCCGTC
AGCTTCGAGGACTTTGTGGCTGGCTTGTCGGTGATTCTTCGGGGAACGGTAGATGACAGA
CTGAATTGGGCCTTCAACTTGTATGACCTCAACAAGGACGGCTGCATCACTAAGGAGGAA
ATGCTCGACATCATGAAGTCCATCTATGACATGATGGGCAAGTACACGTACCCTGCACTC
CGGGAGGAGCCCCCAAGGGAACATGTGGAGAGCTTCTTCCAGAAGATGGACAGAAACAAG
GATGGAGTGGTGACCATTGAGGAATTCATTGAGTCTTGTCAAAAGGACGAGAACATCATG
AGGTCCATGCAGCTCTTTGACAATGTCATCTAG

• efhand (PF00036 )

• None

• None

>Kv channel-interacting protein 2
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQVLPSVSETLAA
PASLRPHRPRPLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPS
GIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDR
LNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNK
DGVVTIEEFIESCQKDENIMRSMQLFDNVI

1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
6. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ: Modulation of A-type potassium channels by a family of calcium sensors. Nature. 2000 Feb 3;403(6769):553-6. [PubMed:10676964 ]
7. Shibata R, Misonou H, Campomanes CR, Anderson AE, Schrader LA, Doliveira LC, Carroll KI, Sweatt JD, Rhodes KJ, Trimmer JS: A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels. J Biol Chem. 2003 Sep 19;278(38):36445-54. Epub 2003 Jun 26. [PubMed:12829703 ]
8. Lin YL, Chen CY, Cheng CP, Chang LS: Protein-protein interactions of KChIP proteins and Kv4.2. Biochem Biophys Res Commun. 2004 Aug 27;321(3):606-10. [PubMed:15358149 ]
9. Ohya S, Morohashi Y, Muraki K, Tomita T, Watanabe M, Iwatsubo T, Imaizumi Y: Molecular cloning and expression of the novel splice variants of K(+) channel-interacting protein 2. Biochem Biophys Res Commun. 2001 Mar 23;282(1):96-102. [PubMed:11263977 ]
10. Decher N, Uyguner O, Scherer CR, Karaman B, Yuksel-Apak M, Busch AE, Steinmeyer K, Wollnik B: hKChIP2 is a functional modifier of hKv4.3 potassium channels: cloning and expression of a short hKChIP2 splice variant. Cardiovasc Res. 2001 Nov;52(2):255-64. [PubMed:11684073 ]
11. Bahring R, Dannenberg J, Peters HC, Leicher T, Pongs O, Isbrandt D: Conserved Kv4 N-terminal domain critical for effects of Kv channel-interacting protein 2.2 on channel expression and gating. J Biol Chem. 2001 Jun 29;276(26):23888-94. Epub 2001 Apr 3. [PubMed:11287421 ]
12. Deschenes I, Tomaselli GF: Modulation of Kv4.3 current by accessory subunits. FEBS Lett. 2002 Sep 25;528(1-3):183-8. [PubMed:12297301 ]
13. Kim LA, Furst J, Butler MH, Xu S, Grigorieff N, Goldstein SA: Ito channels are octomeric complexes with four subunits of each Kv4.2 and K+ channel-interacting protein 2. J Biol Chem. 2004 Feb 13;279(7):5549-54. Epub 2003 Nov 17. [PubMed:14623880 ]
14. Rhodes KJ, Carroll KI, Sung MA, Doliveira LC, Monaghan MM, Burke SL, Strassle BW, Buchwalder L, Menegola M, Cao J, An WF, Trimmer JS: KChIPs and Kv4 alpha subunits as integral components of A-type potassium channels in mammalian brain. J Neurosci. 2004 Sep 8;24(36):7903-15. [PubMed:15356203 ]
15. Kim LA, Furst J, Gutierrez D, Butler MH, Xu S, Goldstein SA, Grigorieff N: Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21 Angstrom resolution. Neuron. 2004 Feb 19;41(4):513-9. [PubMed:14980201 ]