Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07772
Secondary Accession Numbers
  • 13481
Name Late cornified envelope protein 2B
Synonyms
  1. Late envelope protein 10
  2. Skin-specific protein Xp5
  3. Small proline-rich-like epidermal differentiation complex protein 1B
Gene Name LCE2B
Protein Type Unknown
Biological Properties
General Function Involved in keratinization
Specific Function Precursors of the cornified envelope of the stratum corneum
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21
SNPs LCE2B
Gene Sequence
>333 bp
ATGTCTTGCCAGCAAAACCAGCAGCAGTGCCAGCCCCCTCCCAAGTGTCCTCCCAAGTGT
ACCCCAAAATGTCCACCTAAGTGTCCCCCTAAATGCCTGCCCCAGTGCCCAGCTCCATGT
TCCCCTGCAGTCTCTTCTTGCTGTGGTCCCATCTCTGGGGGCTGCTGTGGTCCCAGCTCT
GGGGGCTGCTGCAACTCTGGGGCTGGTGGCTGCTGCCTGAGCCACCACAGGCCCCGTCTC
TTCCACCGGCGCCGGCACCAGAGCCCCGACTGCTGTGAGAGTGAACCTTCTGGGGGCTCT
GGCTGCTGCCACAGCTCTGGGGGCTGCTGCTGA
Protein Properties
Number of Residues 110
Molecular Weight 11218.8
Theoretical pI 8.13
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Late cornified envelope protein 2B
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS
GGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
GenBank ID Protein 2589188
UniProtKB/Swiss-Prot ID O14633
UniProtKB/Swiss-Prot Entry Name LCE2B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF005080
GeneCard ID LCE2B
GenAtlas ID LCE2B
HGNC ID HGNC:16610
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Jackson B, Tilli CM, Hardman MJ, Avilion AA, MacLeod MC, Ashcroft GS, Byrne C: Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation. J Invest Dermatol. 2005 May;124(5):1062-70. [PubMed:15854049 ]
  3. Zhao XP, Elder JT: Positional cloning of novel skin-specific genes from the human epidermal differentiation complex. Genomics. 1997 Oct 15;45(2):250-8. [PubMed:9344646 ]