You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07815
Secondary Accession Numbers
  • 13524
Name C-type mannose receptor 2
Synonyms
  1. C-type lectin domain family 13 member E
  2. CD280 antigen
  3. Endocytic receptor 180
  4. Macrophage mannose receptor 2
  5. UPAR-associated protein
  6. Urokinase receptor-associated protein
  7. Urokinase-type plasminogen activator receptor-associated protein
Gene Name MRC2
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function May play a role as endocytotic lectin receptor displaying calcium-dependent lectin activity. Internalizes glycosylated ligands from the extracellular space for release in an endosomal compartment via clathrin-mediated endocytosis. May be involved in plasminogen activation system controlling the extracellular level of PLAUR/PLAU, and thus may regulate protease activity at the cell surface. May contribute to cellular uptake, remodeling and degradation of extracellular collagen matrices. May play a role during cancer progression as well as in other chronic tissue destructive diseases acting on collagen turnover. May participate in remodeling of extracellular matrix co-operating with the matrix metalloproteinases (MMPs)
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q23.2
SNPs MRC2
Gene Sequence
>4440 bp
ATGGGGCCCGGCCGGCCGGCCCCCGCGCCCTGGCCTCGTCACCTGCTGCGCTGCGTCCTG
CTCCTCGGGTGCCTGCACCTCGGCCGTCCCGGCGCCCCTGGGGACGCCGCCCTCCCGGAA
CCCAACGTCTTCCTCATCTTCAGCCATGGACTGCAGGGCTGCCTGGAGGCCCAGGGCGGG
CAGGTCAGAGTCACCCCGGCTTGCAATACCAGCCTCCCTGCCCAGCGCTGGAAGTGGGTC
TCCCGAAACCGGCTATTCAACCTGGGTACCATGCAGTGCCTGGGCACAGGCTGGCCAGGC
ACCAACACCACGGCCTCCCTGGGCATGTATGAGTGTGACCGGGAAGCACTGAATCTTCGC
TGGCATTGTCGTACACTGGGTGACCAGCTGTCCTTGCTCCTGGGGGCCCGCACCAGCAAC
ATATCCAAGCCTGGCACCCTTGAGCGTGGTGACCAGACCCGCAGTGGCCAGTGGCGCATC
TACGGCAGCGAGGAGGACCTATGTGCTCTGCCCTACCACGAGGTCTACACCATCCAGGGA
AACTCCCACGGAAAGCCGTGCACCATCCCCTTCAAATATGACAACCAGTGGTTCCACGGC
TGCACCAGCACGGGCCGCGAGGATGGTCACCTGTGGTGTGCCACCACCCAGGACTACGGC
AAAGACGAGCGCTGGGGCTTCTGCCCCATCAAGAGTAACGACTGCGAGACCTTCTGGGAC
AAGGACCAGCTGACTGACAGCTGCTACCAGTTTAACTTCCAGTCCACGCTGTCGTGGAGG
GAGGCCTGGGCCAGCTGCGAGCAGCAGGGTGCGGATCTGCTGAGCATCACGGAGATCCAC
GAGCAGACCTACATCAACGGCCTCCTCACTGGGTACAGCTCCACCCTGTGGATCGGCTTG
AATGACTTGGACACGAGCGGAGGCTGGCAGTGGTCGGACAACTCGCCCCTCAAGTACCTC
AACTGGGAGAGTGACCAGCCGGACAACCCCAGTGAGGAGAACTGTGGAGTGATCCGCACT
GAGTCCTCGGGCGGCTGGCAGAACCGTGACTGCAGCATCGCGCTGCCCTATGTGTGCAAG
AAGAAGCCCAACGCCACGGCCGAGCCCACCCCTCCAGACAGGTGGGCCAATGTGAAGGTG
GAGTGCGAGCCGAGCTGGCAGCCCTTCCAGGGCCACTGCTACCGCCTGCAGGCCGAGAAG
CGCAGCTGGCAGGAGTCCAAGAAGGCATGTCTACGGGGCGGTGGCGACCTGGTCAGCATC
CACAGCATGGCGGAGCTGGAATTCATCACCAAGCAGATCAAGCAAGAGGTGGAGGAGCTG
TGGATCGGCCTCAACGATTTGAAACTGCAGATGAATTTTGAGTGGTCTGACGGGAGCCTT
GTGAGCTTCACCCACTGGCACCCCTTTGAGCCCAACAACTTCCGGGACAGTCTGGAGGAC
TGTGTCACCATCTGGGGCCCGGAAGGCCGCTGGAACGACAGTCCCTGTAACCAGTCCTTG
CCATCCATCTGCAAGAAGGCAGGCCAGCTGAGCCAGGGGGCCGCCGAGGAGGACCATGGC
TGCCGGAAGGGTTGGACGTGGCACAGCCCATCCTGCTACTGGCTGGGAGAAGACCAAGTG
ACCTACAGTGAGGCCCGGCGCCTGTGCACTGACCATGGCTCTCAGCTGGTCACCATCACC
AACAGGTTCGAGCAGGCCTTCGTCAGCAGCCTCATCTACAACTGGGAGGGCGAGTACTTC
TGGACGGCCCTGCAGGACCTCAACAGCACCGGCTCCTTCTTCTGGCTCAGTGGGGATGAA
GTCATGTACACCCACTGGAACCGGGACCAGCCCGGGTACAGCCGTGGGGGCTGCGTGGCG
CTGGCCACTGGCAGCGCCATGGGGCTGTGGGAGGTGAAGAACTGTACCTCGTTCCGGGCC
CGCTACATCTGCCGGCAGAGCCTGGGCACTCCAGTGACGCCGGAGCTGCCGGGGCCAGAT
CCCACGCCCAGCCTCACTGGCTCCTGTCCCCAGGGCTGGGCCTCGGACACCAAACTCCGG
TATTGCTATAAGGTGTTCAGCTCAGAGCGGCTGCAGGACAAGAAGAGCTGGGTCCAGGCC
CAGGGGGCCTGCCAGGAGCTGGGGGCCCAGCTGCTGAGCCTGGCCAGCTACGAGGAGGAG
CACTTTGTGGCCAACATGCTCAACAAGATCTTCGGTGAATCAGAACCCGAGATCCACGAG
CAGCACTGGTTCTGGATCGGCCTGAACCGTCGGGATCCCAGAGGGGGTCAGAGTTGGCGC
TGGAGCGACGGCGTAGGGTTCTCTTACCACAATTTCGACCGGAGCCGGCACGACGACGAC
GACATCCGAGGCTGTGCGGTGCTGGACCTGGCCTCCCTGCAGTGGGTGGCCATGCAGTGC
GACACACAGCTGGACTGGATCTGCAAGATCCCCAGAGGTACGGACGTGCGGGAGCCCGAC
GACAGCCCTCAAGGCCGACGGGAATGGCTGCGCTTCCAGGAGGCCGAGTACAAGTTCTTT
GAGCACCACTCCACGTGGGCGCAGGCGCAGCGCATCTGCACGTGGTTCCAGGCCGAGCTG
ACCTCGGTGCACAGCCAGGCGGAGCTAGACTTCCTGAGCCACAACTTGCAGAAGTTCTCC
CGGGCCCAGGAGCAGCACTGGTGGATCGGCCTGCACACCTCTGAGAGCGATGGGCGCTTC
AGATGGACAGATGGTTCCATTATAAACTTCATCTCCTGGGCACCAGGCAAACCTCGGCCT
GTCGGCAAGGACAAGAAGTGCGTGTACATGACAGCCAGCCGAGAGGACTGGGGGGACCAG
AGGTGCCTGACAGCCTTGCCCTACATCTGCAAGCGCAGCAACGTCACCAAAGAAACGCAG
CCCCCAGACCTGCCAACTACAGCCCTGGGGGGCTGCCCCTCTGACTGGATCCAGTTCCTC
AACAAGTGTTTTCAGGTCCAGGGCCAGGAACCCCAGAGCCGGGTGAAGTGGTCAGAGGCA
CAGTTCTCCTGTGAACAGCAAGAGGCCCAGCTGGTCACCATCACAAACCCCTTAGAGCAA
GCATTCATCACAGCCAGCCTGCCCAATGTGACCTTTGACCTTTGGATTGGCCTCCATGCC
TCGCAGAGGGACTTCCAGTGGGTGGAGCAGGAGCCTTTGATGTATGCCAACTGGGCACCT
GGGGAGCCCTCTGGCCCTAGCCCTGCTCCCAGTGGCAACAAACCGACCAGCTGTGCAGTG
GTCCTGCACAGCCCCTCAGCCCACTTCACTGGCCGCTGGGACGATCGGAGCTGCACGGAG
GAGACCCATGGCTTCATCTGCCAGAAGGGCACGGACCCCTCCCTGAGCCCGTCCCCAGCA
GCGCTGCCCCCCGCCCCGGGCACTGAGCTCTCCTACCTCAACGGCACCTTCCGGCTGCTT
CAGAAGCCGCTGCGCTGGCACGATGCCCTCCTGCTGTGTGAGAGCCGCAATGCCAGCCTG
GCCTACGTGCCCGACCCCTACACCCAGGCCTTCCTCACGCAGGCTGCCCGAGGGCTGCGC
ACGCCGCTCTGGATTGGGCTGGCTGGCGAGGAGGGCTCTCGGCGGTACTCCTGGGTCTCA
GAGGAGCCGCTGAACTACGTGGGCTGGCAGGACGGGGAGCCGCAGCAGCCGGGGGGCTGT
ACCTACGTAGATGTGGACGGGGCCTGGCGCACCACCAGCTGTGACACCAAGCTGCAGGGG
GCTGTGTGTGGGGTTAGCAGTGGGCCCCCTCCTCCCCGAAGAATAAGCTACCATGGCAGC
TGTCCCCAGGGACTGGCAGACTCCGCGTGGATTCCCTTCCGGGAGCACTGCTATTCTTTC
CACATGGAGCTGCTGCTGGGCCACAAGGAGGCGCGACAGCGCTGCCAGAGAGCGGGTGGG
GCCGTCCTGTCTATCCTGGATGAGATGGAGAATGTGTTTGTCTGGGAGCACCTGCAGAGC
TATGAGGGCCAGAGTCGGGGCGCCTGGCTGGGCATGAACTTCAACCCCAAAGGAGGCACT
CTGGTCTGGCAGGACAACACAGCTGTGAACTACTCCAACTGGGGGCCCCCGGGCTTGGGC
CCCAGCATGCTGAGCCACAACAGCTGCTACTGGATTCAGAGCAACAGCGGGCTATGGCGC
CCCGGCGCTTGCACCAACATCACCATGGGTGTCGTCTGCAAGCTTCCTCGTGCTGAGCAG
AGCAGCTTCTCCCCATCAGCGCTTCCAGAGAACCCAGCGGCCCTGGTGGTGGTGCTGATG
GCGGTGCTGCTGCTCCTGGCCTTGCTGACCGCAGCCCTCATCCTTTACCGGAGGCGCCAG
AGCATCGAGCGCGGGGCCTTTGAGGGTGCCCGCTACAGCCGCAGCAGCTCCAGCCCCACC
GAGGCCACTGAGAAGAACATCCTGGTGTCAGACATGGAAATGAATGAGCAACAAGAATAG
Protein Properties
Number of Residues 1479
Molecular Weight 166654.2
Theoretical pI 5.64
Pfam Domain Function
Signals
  • 1-30
Transmembrane Regions
  • 1415-1435
Protein Sequence
>C-type mannose receptor 2
MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRF
RWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQ
PPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ
AFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAV
VLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLL
QKPLRWHDALLLCESHNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS
EEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQS
YEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNITMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE
GenBank ID Protein 110624774
UniProtKB/Swiss-Prot ID Q9UBG0
UniProtKB/Swiss-Prot Entry Name MRC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006039.3
GeneCard ID MRC2
GenAtlas ID MRC2
HGNC ID HGNC:16875
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Blomster HA, Imanishi SY, Siimes J, Kastu J, Morrice NA, Eriksson JE, Sistonen L: In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification. J Biol Chem. 2010 Jun 18;285(25):19324-9. doi: 10.1074/jbc.M110.106955. Epub 2010 Apr 13. [PubMed:20388717 ]
  4. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  5. Behrendt N, Jensen ON, Engelholm LH, Mortz E, Mann M, Dano K: A urokinase receptor-associated protein with specific collagen binding properties. J Biol Chem. 2000 Jan 21;275(3):1993-2002. [PubMed:10636902 ]
  6. Sheikh H, Yarwood H, Ashworth A, Isacke CM: Endo180, an endocytic recycling glycoprotein related to the macrophage mannose receptor is expressed on fibroblasts, endothelial cells and macrophages and functions as a lectin receptor. J Cell Sci. 2000 Mar;113 ( Pt 6):1021-32. [PubMed:10683150 ]
  7. Wu K, Yuan J, Lasky LA: Characterization of a novel member of the macrophage mannose receptor type C lectin family. J Biol Chem. 1996 Aug 30;271(35):21323-30. [PubMed:8702911 ]
  8. Howard MJ, Isacke CM: The C-type lectin receptor Endo180 displays internalization and recycling properties distinct from other members of the mannose receptor family. J Biol Chem. 2002 Aug 30;277(35):32320-31. Epub 2002 Jun 14. [PubMed:12068012 ]
  9. East L, Rushton S, Taylor ME, Isacke CM: Characterization of sugar binding by the mannose receptor family member, Endo180. J Biol Chem. 2002 Dec 27;277(52):50469-75. Epub 2002 Oct 23. [PubMed:12399458 ]
  10. Wienke D, MacFadyen JR, Isacke CM: Identification and characterization of the endocytic transmembrane glycoprotein Endo180 as a novel collagen receptor. Mol Biol Cell. 2003 Sep;14(9):3592-604. Epub 2003 Jul 25. [PubMed:12972549 ]