You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07818
Secondary Accession Numbers
  • 13527
Name Protein MRVI1
Synonyms
  1. Inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
  2. JAW1-related protein MRVI1
Gene Name MRVI1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Play a role as NO/PRKG1-dependent regulator of IP3- induced calcium release; its phosphorylation by PRKG1 inhibits bradykinin and IP3-induced calcium release from intracellular stores. Recruits PRKG1 to the endoplasmic reticulum and may mediate the assembly of PRKG1 and ITPR1 in a macrocomplex. Involved in PRKG1 signaling cascade leading to inhibition of platelet activation and aggregation. Mediates also NO-dependent inhibition of calcium signaling in gastrointestinal smooth muscle contributing to NO-dependent relaxation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Membrane
  4. Single-pass membrane protein (Potential)
  5. Sarcoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15
SNPs MRVI1
Gene Sequence
>2466 bp
CTGACTGGGGATGCCACTTCACCAGAAGGAGAAACCGACAAAAACCTGGCCAACAGAGTT
CACAGTCCCCACAAGAGGCTTTCTCACCGACACTTGAAGGTGTCCACTGCCTCCCTGACA
TCTGTGGACCCCGCGGGGCACATCATTGACCTGGTGAATGACCAGCTGCCAGACATCAGC
ATCTCAGAGGAGGACAAGAAGAAAAACCTGGCGCTGCTGGAAGAAGCCAAGTTGGTGAGT
GAGCGATTCCTGACCCGCCGTGGGAGGAAGTCCAGGAGCAGCCCCGGAGACTCCCCATCA
GCTGTTTCCCCGAACCTCAGCCCCAGCGCTTCTCCTACATCCTCTCGGAGCAACTCACTT
ACAGTCCCCACCCCGCCAGGTTTGGATGTGTGCAGTGGCCCGCCATCCCCTCTGCCTGGA
GCACCACCACAGAAGGGGGATGAGGCCGACGTCTCTTCACCTCACCCTGGCGAGCCTAAC
GTCCCCAAAGGGCTAGCTGACAGGAAGCAGAATGACCAGAGGAAAGTGTCTCAGGGCAGG
CTGGCTCCTCGTCCTCCTCCAGTTGAGAAGTCCAAAGAGATTGCAATAGAACAAAAGGAA
AACTTCGATCCCCTCCAGTACCCCGAGACCACACCCAAAGGCCTAGCTCCTGTTACAAAC
AGCAGTGGGAAAATGGCCCTGAACAGCCCTCAGCCTGGCCCCGTGGAGAGCGAGCTGGGG
AAGCAGCTCTTGAAAACGGGCTGGGAGGGCAGCCCTCTGCCGAGAAGTCCAACCCAGGAT
GCGGCAGGAGTGGGTCCCCCAGCCTCCCAGGGGAGAGGCCCAGCTGGAGAGCCGATGGGG
CCCGAGGCTGGCTCCAAAGCTGAGCTTCCACCCACTGTGTCCCGGCCCCCGCTGCTGCGA
GGGCTCTCCTGGGACAGTGGCCCTGAAGAACCTGGCCCCCGGCTGCAGAAAGTGCTTGCC
AAGCTGCCACTGGCAGAGGAAGAAAAGCGTTTTGCAGGCAAGGCCGGCGGCAAGCTGGCC
AAGGCCCCTGGTCTCAAAGACTTTCAGATACAAGTGCAGCCCGTGCGGATGCAGAAACTG
ACCAAGCTCCGAGAGGAGCACATCCTGATGAGAAATCAGAACTTAGTGGGGCTCAAGCTT
CCAGACCTTAGTGAAGCAGCTGAGCAGGAAAAAGGGCTTCCTTCTGAACTCTCCCCAGCT
ATTGAGGAAGAAGAGTCAAAGAGTGGCTTAGATGTCATGCCTAATATTTCTGATGTGCTG
CTGCGCAAACTGCGGGTCCACAGGAGTCTCCCTGGAAGTGCCCCTCCACTCACTGAAAAG
GAAGTTGAGAACGTGTTTGTGCAACTGTCCTTGGCCTTTAGAAATGACAGCTACACTCTG
GAATCTAGAATTAACCAGGCTGAAAGGGAACGCAACCTGACAGAGGAGAACACTGAGAAA
GAACTGGAAAACTTCAAAGCTTCCATTACGTCCTCAGCTTCACTCTGGCACCACTGTGAG
CACCGGGAAACCTACCAGAAGTTGCTGGAGGACATCGCTGTCCTGCACCGCCTGGCTGCC
CGCCTCTCCAGCCGAGCTGAGGTGGTAGGCGCCGTCCGCCAGGAAAAGCGCATGTCGAAA
GCAACGGAAGTGATGATGCAGTATGTGGAGAATCTAAAGAGGACGTATGAGAAGGACCAT
GCGGAGCTCATGGAGTTTAAAAAGCTTGCAAATCAGAATTCAAGCCGCAGCTGTGGCCCC
TCTGAAGATGGGGTCCCTCGCACGGCACGGTCCATGTCCCTCACGCTGGGAAAGAATATG
CCTCGCCGGAGGGTCAGCGTTGCTGTGGTTCCTAAGTTTAATGCCCTGAATCTGCCTGGC
CAAACTCCCAGCTCATCATCCATTCCCTCCTTACCAGCCTTGTCGGAATCACCCAATGGG
AAAGGCAGCCTACCTGTCACTTCAGCACTGCCTGCACTTTTGGAAAATGGAAAGACAAAT
GGGGACCCAGATTGTGAAGCCTCTGCTCCTGCGCTGACCCTGAGCTGCCTGGAGGAGCTT
AGTCAGGAGACCAAGGCCAGGATGGAGGAAGAAGCCTACAGCAAGGGATTCCAAGAAGGT
CTAAAGAAGACCAAAGAACTTCAAGACCTGAAGGAGGAGGAGGAAGAACAGAAGAGTGAG
AGTCCTGAGGAACCTGAAGAGGTAGAAGAAACTGAGGAAGAGGAAAAGGGCCCAAGAAGC
AGCAAACTTGAAGAATTGGTCCATTTCTTACAAGTCATGTATCCCAAACTGTGTCAGCAC
TGGCAAGTGATCTGGATGATGGCTGCAGTGATGCTGGTCTTGACTGTTGTGCTGGGGCTC
TACAATTCCTATAACTCTTGTGCAGAGCAGGCTGATGGGCCCCTTGGAAGATCCACTTGC
TCGGCAGCCCAGAGGGACTCCTGGTGGAGCTCAGGACTCCAGCATGAGCAGCCTACAGAG
CAGTAG
Protein Properties
Number of Residues 885
Molecular Weight 96144.2
Theoretical pI 5.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 825-845
Protein Sequence
>Protein MRVI1
MGMDLTCPFGISPACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDEEPPGEPQAA
QSPAGQGPPAAGVSCSPTPTIVLTGDATSPEGETDKNLANRVHSPHKRLSHRHLKVSTAS
LTSVDPAGHIIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDS
PSAVSPNLSPSASPTSSRSNSLTVPTPPDGDEADVSSPHPGEPNVPKGLADRKQNDQRKV
SQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKGLAPVTNSSGKMALNSPQPGPVE
SELGKQLLKTGWEGSPLPRSPTQDAAGVGPPASQGRGPAGEPMGPEAGSKAELPPTVSRP
PLLRGLSWDSGPEEPGPRLQKVLAKLPLAEEEKRFAGKAGGKLAKAPGLKDFQIQVQPVR
MQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSELSPAIEEEESKSGLDVMPNI
SDVLLRKLRVHRSLPGSAPPLTEKEVENVFVQLSLAFRNDSYTLESRINQAERERNLTEE
NTEKELENFKASITSSASLWHHCEHRETYQKLLEDIAVLHRLAARLSSRAEVVGAVRQEK
RMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNSSRSCGPSEDGVPRTARSMSLTL
GKNMPRRRVSVAVVPKFNALNLPGQTPSSSSIPSLPALSESPNGKGSLPVTSALPALLEN
GKTNGDPDCEASAPALTLSCLEELSQETKARMEEEAYSKGFQEGLKKTKELQDLKEEEEE
QKSESPEEPEEVEETEEEEKGPRSSKLEELVHFLQVMYPKLCQHWQVIWMMAAVMLVLTV
VLGLYNSYNSCAEQADGPLGRSTCSAAQRDSWWSSGLQHEQPTEQ
GenBank ID Protein 148728182
UniProtKB/Swiss-Prot ID Q9Y6F6
UniProtKB/Swiss-Prot Entry Name MRVI1_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID MRVI1
GenAtlas ID MRVI1
HGNC ID HGNC:7237
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Antl M, von Bruhl ML, Eiglsperger C, Werner M, Konrad I, Kocher T, Wilm M, Hofmann F, Massberg S, Schlossmann J: IRAG mediates NO/cGMP-dependent inhibition of platelet aggregation and thrombus formation. Blood. 2007 Jan 15;109(2):552-9. Epub 2006 Sep 21. [PubMed:16990611 ]
  4. Shaughnessy JD Jr, Largaespada DA, Tian E, Fletcher CF, Cho BC, Vyas P, Jenkins NA, Copeland NG: Mrvi1, a common MRV integration site in BXH2 myeloid leukemias, encodes a protein with homology to a lymphoid-restricted membrane protein Jaw1. Oncogene. 1999 Mar 25;18(12):2069-84. [PubMed:10321731 ]
  5. Fritsch RM, Saur D, Kurjak M, Oesterle D, Schlossmann J, Geiselhoringer A, Hofmann F, Allescher HD: InsP3R-associated cGMP kinase substrate (IRAG) is essential for nitric oxide-induced inhibition of calcium signaling in human colonic smooth muscle. J Biol Chem. 2004 Mar 26;279(13):12551-9. Epub 2004 Jan 18. [PubMed:14729908 ]
  6. Kusumawidjaja G, Kayed H, Giese N, Bauer A, Erkan M, Giese T, Hoheise JD, Friess H, Kleeff J: Basic transcription factor 3 (BTF3) regulates transcription of tumor-associated genes in pancreatic cancer cells. Cancer Biol Ther. 2007 Mar;6(3):367-76. Epub 2007 Mar 13. [PubMed:17312387 ]