Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07839
Secondary Accession Numbers
  • 13548
Name Neurogranin
Synonyms
  1. NEUG(55-78)
  2. Ng
  3. RC3
Gene Name NRGN
Protein Type Unknown
Biological Properties
General Function Involved in calmodulin binding
Specific Function Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11q24
SNPs NRGN
Gene Sequence
>237 bp
ATGGACTGCTGCACCGAGAACGCCTGCTCCAAGCCGGACGACGACATTCTAGACATCCCG
CTGGACGATCCCGGCGCCAACGCGGCCGCCGCCAAAATCCAGGCGAGTTTTCGGGGCCAC
ATGGCGCGGAAGAAGATAAAGAGCGGAGAGCGCGGCCGGAAGGGCCCGGGCCCTGGGGGG
CCTGGCGGAGCTGGGGTGGCCCGGGGAGGCGCGGGCGGCGGCCCCAGCGGAGACTAG
Protein Properties
Number of Residues 78
Molecular Weight 7618.4
Theoretical pI 8.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Neurogranin
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG
PGGAGVARGGAGGGPSGD
GenBank ID Protein 13872825
UniProtKB/Swiss-Prot ID Q92686
UniProtKB/Swiss-Prot Entry Name NEUG_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ317956
GeneCard ID NRGN
GenAtlas ID NRGN
HGNC ID HGNC:8000
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Mertsalov IB, Gundelfinger E, Tsetlin VI: [Cloning cDNA for human neurogranin]. Bioorg Khim. 1996 May;22(5):366-9. [PubMed:8929222 ]
  4. Mertsalov IB, Stumm M, Wieacker P, tom Dieck S, Gundelfinger E, Tsetlin VI: [Structure and chromosomal localization of human neurogranin gene]. Bioorg Khim. 1997 Dec;23(12):961-8. [PubMed:9499372 ]
  5. Martinez de Arrieta C, Perez Jurado L, Bernal J, Coloma A: Structure, organization, and chromosomal mapping of the human neurogranin gene (NRGN). Genomics. 1997 Apr 15;41(2):243-9. [PubMed:9143500 ]
  6. Chang JW, Schumacher E, Coulter PM 2nd, Vinters HV, Watson JB: Dendritic translocation of RC3/neurogranin mRNA in normal aging, Alzheimer disease and fronto-temporal dementia. J Neuropathol Exp Neurol. 1997 Oct;56(10):1105-18. [PubMed:9329454 ]