You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07854
Secondary Accession Numbers
  • 13563
Name Neurotensin receptor type 2
Synonyms
  1. Levocabastine-sensitive neurotensin receptor
  2. NT-R-2
  3. NTR2
Gene Name NTSR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for the tridecapeptide neurotensin. It is associated with G proteins that activate a phosphatidylinositol- calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
neurotensin receptor activity, g-protein coupled
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2p25.1
SNPs NTSR2
Gene Sequence
>1233 bp
ATGGAAACCAGCAGCCCGCGGCCCCCGCGGCCCAGCTCCAACCCGGGGCTGAGCCTGGAC
GCCCGGCTGGGCGTGGACACTCGCCTCTGGGCCAAGGTGCTGTTCACCGCGCTCTACGCA
CTCATCTGGGCGCTGGGCGCGGCGGGCAATGCGCTGTCCGTGCACGTGGTGCTGAAGGCG
CGGGCCGGGCGCGCGGGGCGCCTGCGCCACCACGTGCTCAGCCTGGCGCTCGCGGGCCTG
CTGCTGCTGCTGGTCGGCGTGCCGGTGGAGCTCTACAGCTTCGTGTGGTTCCACTACCCC
TGGGTCTTCGGCGACCTGGGCTGCCGCGGCTACTACTTCGTGCACGAGCTGTGCGCCTAC
GCCACGGTGCTGAGCGTGGCAGGCCTGAGCGCCGAGCGCTGCCTAGCCGTGTGCCAGCCC
CTGCGTGCCCGCAGCCTGCTGACGCCACGCCGGACCCGGTGGCTGGTGGCGCTCTCGTGG
GCCGCCTCGCTCGGCCTCGCCCTGCCCATGGCCGTCATCATGGGGCAGAAGCACGAACTC
GAGACGGCGGACGGGGAGCCGGAGCCCGCCTCGCGAGTGTGCACGGTGCTGGTGAGCCGC
ACCGCGCTCCAAGTCTTTATCCAGGTGAATGTGCTGGTGTCCTTCGTGCTCCCCTTGGCA
CTAACTGCTTTCCTGAATGGGGTCACAGTGAGCCACCTGCTGGCCCTCTGCTCCCAAGTG
CCGTCCACTTCTACCCCGGGCAGCTCCACCCCCAGCCGCCTGGAGCTGCTGAGTGAGGAG
GGTCTCCTCAGCTTCATCGTATGGAAGAAGACCTTTATCCAGGGAGGCCAGGTCAGCCTG
GTGAGACATAAAGACGTGCGCCGGATCCGCAGCCTCCAGCGCAGCGTCCAGGTTCTCAGA
GCCATCGTGGTCATGTATGTCATCTGCTGGCTGCCGTACCATGCCCGCAGGCTCATGTAC
TGCTACGTACCTGATGACGCGTGGACTGACCCACTGTACAATTTCTACCACTACTTCTAC
ATGGTGACCAACACACTTTTCTACGTCAGCTCAGCTGTGACTCCTCTTCTCTACAACGCC
GTGTCCTCCTCCTTCAGAAAACTCTTCCTGGAAGCCGTCAGCTCCCTGTGTGGAGAGCAC
CACCCCATGAAGCGGTTACCCCCGAAGCCCCAGAGTCCCACCCTAATGGATACAGCTTCA
GGCTTTGGGGATCCCCCAGAAACCCGGACCTGA
Protein Properties
Number of Residues 410
Molecular Weight 45412.7
Theoretical pI 9.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 33-55
  • 65-87
  • 110-131
  • 155-176
  • 218-237
  • 298-318
  • 338-358
Protein Sequence
>Neurotensin receptor type 2
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSVHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
GenBank ID Protein 3901028
UniProtKB/Swiss-Prot ID O95665
UniProtKB/Swiss-Prot Entry Name NTR2_HUMAN
PDB IDs Not Available
GenBank Gene ID Y10148
GeneCard ID NTSR2
GenAtlas ID NTSR2
HGNC ID HGNC:8040
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Vita N, Oury-Donat F, Chalon P, Guillemot M, Kaghad M, Bachy A, Thurneyssen O, Garcia S, Poinot-Chazel C, Casellas P, Keane P, Le Fur G, Maffrand JP, Soubrie P, Caput D, Ferrara P: Neurotensin is an antagonist of the human neurotensin NT2 receptor expressed in Chinese hamster ovary cells. Eur J Pharmacol. 1998 Nov 6;360(2-3):265-72. [PubMed:9851594 ]