You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07879
Secondary Accession Numbers
  • 13590
Name Protocadherin alpha-2
Synonyms
  1. PCDH-alpha-2
Gene Name PCDHA2
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31
SNPs PCDHA2
Gene Sequence
>2847 bp
ATGGCGTCTTCTATCAGAAGGGGCCGAGGGGCCTGGACACGGCTGCTCTCGCTTCTGCTC
CTCGCAGCCTGGGAGGTGGGGAGCGGCCAGCTCCGCTACTCCGTCCCCGAGGAGGCCAAA
CACGGCACCTTCGTGGGCCGCATCGCGCAGGACCTGGGGCTGGAGCTGGAGGAGCTGGTG
CCGCGCCTGTTCCGGGTGGCGTCCAAAAGACACGGGGACCTTCTGGAGGTAAATCTGCAG
AATGGCATTTTGTTTGTGAATTCTCGGATCGACCGGGAGGAGCTGTGCGGGCGGAGCGCG
GAATGTAGCATCCACGTGGAGGTGATCGTGGACAGGCCGCTGCAGGTTTTCCATGTGGAA
GTGGAGGTGAAGGACATTAACGACAACCCGCCAATATTTCCAATGACAGTAAAGACTATC
CGGTTTCCCGAATCAAGGCTGCTTGATTCTCGGTTTCCTCTAGAGGGAGCATCTGATGCA
GATATAGGAGTAAATGCTCTTCTCTCCTACAAGCTCAGCTCCAGTGAGTTTTTCTTCCTA
GATATACAGGCAAATGATGAACTAAGCGAATCTTTGTCTCTCGTGCTGGGGAAATCGCTG
GACAGAGAGGAAACTGCTGAGGTTAATTTGTTACTGGTGGCTACTGATGGGGGCAAACCT
GAGCTCACGGGCACCGTTCAAATACTTATTAAGGTATTAGATGTAAATGACAATGAACCA
ACTTTTGCCCAATCAGTTTACAAAGTAAAATTGTTAGAGAATACGGCAAATGGGACCTTA
GTGGTTAAGTTAAACGCTTCTGATGCAGATGAAGGACCGAACAGCGAGATTGTGTATTCA
CTCGGTAGTGATGTGTCCTCCACTATACAGACTAAGTTTACCATAGATCCCATCTCAGGG
GAAATCAGAACTAAGGGAAAATTAGATTATGAAGAAGCAAAGTCCTACGAGATTCAGGTC
ACTGCAACTGACAAAGGAACCCCTTCAATGTCAGGACATTGTAAAATTTCATTAAAACTT
GTGGACATCAATGATAACACACCAGAAGTCTCAATAACGTCTCTCTCACTTCCCATCTCA
GAGAACGCTTCCCTGGGCACTGTCATTGCTCTCATCACGGTGTCGGATCGCGACTCTGGT
ACGAATGGACATGTCACCTGCTCCCTGACGCCCCACGTCCCTTTCAAGCTGGTGTCCACC
TTCAAGAATTACTACTCGTTGGTGCTGGACAGCGCCCTGGACCGCGAGAGCGTGTCAGCC
TATGAGCTGGTGGTGACCGCACGGGACGGGGGCTCGCCTTCACTGTGGGCCACCACCAGC
GTGTCCATCGAGGTGGCCGACGTGAACGACAACGCGCCGGCGTTCGCACAGCCTGAGTAC
ACAGTATTCGTGAAGGAGAACAACCCGCCGGGCTGCCACATCTTCACGGTGTCAGCGTGG
GATGCGGACGCGCAGGAGAACGCGCTGGTGTCCTACTCGCTGGTGGAGCGGCGGGTGGGC
GAGCGCGCGTTGTCGAGCTACGTTTCGGTGCACGCGGAGAGCGGCAAGGTGTACGCGCTG
CAGCCGCTGGACCACGAGGAAGTGGAGCTGCTGCAGTTCCAGGTGAGCGCGCGGGATGCG
GGCGTGCCGCCTCTGGGCAGCAACGTGACGCTGCAGGTGTTCGTGCTGGACGAGAACGAC
AACGCGCCGGCACTGTTGGCGCCTAGGGCTGGCACCGCTGCTGGCGCAGTGAGTGAGCTG
GTGCCGTGGTCGGTGGGTGCAGGGCACGTGGTGGCGAAGGTGCGCGCAGTGGACGCTGAC
TCAGGCTACAACGCGTGGCTTTCGTACGAGCTTCAGCTGGGTACTGGCAGCGCTCGCATC
CCGTTCCGCGTGGGGCTATACACGGGTGAGATCAGCACGACACGTGCCCTAGACGAGGCT
GACTCCCCTCGACACCGCCTACTCGTGCTGGTGAAGGACCACGGCGAACCAGCGTTGACA
GCCACGGCCACCGTGTTAGTGTCGTTGGTGGAAAGTGGCCAGGCACCCAAGGCCTCGTCG
CGGGCGTGGGTGGGCGCCGCGGGCTCAGAGGCTACGCTGGTGGATGTCAACGTGTACCTG
ATCATCGCCATCTGCGCGGTATCCAGCCTGTTGGTGCTCACGGTGCTGCTGTACACTGCG
CTGCGGTGCTCGGTGCCACCCACCGAGGGTGCGCGCGCGCCAGGAAAGCCCACGCTGGTG
TGCTCCAGCGCCGTGGGGAGCTGGTCTTACTCGCAGCAGAGGCGGCAGAGGGTGTGCTCT
GGGGAGGACCCCCCCAAGACGGACCTCATGGCCTTCAGCCCTAGCTTATCTCAAGGTCCA
GACTCCGCAGAAGAGAAACAGCTCTCAGAATCAGAATACGTAGGAAAGCCACGACAGCCC
AACCCTGACTGGCGTTACTCTGCCTCCCTGAGAGCAGGCATGCACAGCTCTGTGCACCTA
GAGGAGGCTGGCATTCTACGGGCTGGTCCAGGAGGGCCTGATCAGCAGTGGCCAACAGTA
TCCAGTGCAACACCAGAACCAGAGGCAGGAGAAGTGTCCCCTCCAGTCGGTGCGGGTGTC
AACAGCAACAGCTGGACCTTTAAATACGGACCAGGCAACCCCAAACAATCCGGTCCCGGT
GAGTTGCCCGACAAATTCATTATCCCAGGATCTCCTGCAATCATCTCCATCCGGCAGGAG
CCTACTAACAGCCAAATTGACAAAAGTGACTTCATAACCTTCGGCAAAAAGGAGGAGACC
AAGAAAAAGAAGAAAAAGAAGAAGGGTAACAAGACCCAGGAGAAAAAAGAGAAAGGGAAC
AGCACGACTGACAACAGTGACCAGTGA
Protein Properties
Number of Residues 948
Molecular Weight 102061.8
Theoretical pI 4.83
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 698-718
Protein Sequence
>Protocadherin alpha-2
MASSIRRGRGAWTRLLSLLLLAAWEVGSGQLRYSVPEEAKHGTFVGRIAQDLGLELEELV
PRLFRVASKRHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHVEVIVDRPLQVFHVE
VEVKDINDNPPIFPMTVKTIRFPESRLLDSRFPLEGASDADIGVNALLSYKLSSSEFFFL
DIQANDELSESLSLVLGKSLDREETAEVNLLLVATDGGKPELTGTVQILIKVLDVNDNEP
TFAQSVYKVKLLENTANGTLVVKLNASDADEGPNSEIVYSLGSDVSSTIQTKFTIDPISG
EIRTKGKLDYEEAKSYEIQVTATDKGTPSMSGHCKISLKLVDINDNTPEVSITSLSLPIS
ENASLGTVIALITVSDRDSGTNGHVTCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVSA
YELVVTARDGGSPSLWATTSVSIEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAW
DADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEEVELLQFQVSARDA
GVPPLGSNVTLQVFVLDENDNAPALLAPRAGTAAGAVSELVPWSVGAGHVVAKVRAVDAD
SGYNAWLSYELQLGTGSARIPFRVGLYTGEISTTRALDEADSPRHRLLVLVKDHGEPALT
ATATVLVSLVESGQAPKASSRAWVGAAGSEATLVDVNVYLIIAICAVSSLLVLTVLLYTA
LRCSVPPTEGARAPGKPTLVCSSAVGSWSYSQQRRQRVCSGEDPPKTDLMAFSPSLSQGP
DSAEEKQLSESEYVGKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTV
SSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQE
PTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
GenBank ID Protein 9256584
UniProtKB/Swiss-Prot ID Q9Y5H9
UniProtKB/Swiss-Prot Entry Name PCDA2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018905.2
GeneCard ID PCDHA2
GenAtlas ID PCDHA2
HGNC ID HGNC:8668
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  4. Wu Q, Maniatis T: A striking organization of a large family of human neural cadherin-like cell adhesion genes. Cell. 1999 Jun 11;97(6):779-90. [PubMed:10380929 ]